Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4667734..4668488 | Replicon | chromosome |
| Accession | NZ_CP120343 | ||
| Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain PS_Mu_4_2021 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P1708_RS22845 | Protein ID | WP_000558166.1 |
| Coordinates | 4667734..4668045 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1708_RS22850 | Protein ID | WP_001259012.1 |
| Coordinates | 4668042..4668488 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1708_RS22815 (4663392) | 4663392..4664294 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| P1708_RS22820 (4664291) | 4664291..4664926 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1708_RS22825 (4664923) | 4664923..4665852 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P1708_RS22830 (4665899) | 4665899..4666189 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P1708_RS22835 (4666190) | 4666190..4666501 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P1708_RS22840 (4666719) | 4666719..4667648 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| P1708_RS22845 (4667734) | 4667734..4668045 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P1708_RS22850 (4668042) | 4668042..4668488 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P1708_RS22855 (4668503) | 4668503..4669444 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1708_RS22860 (4669489) | 4669489..4669926 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| P1708_RS22865 (4669923) | 4669923..4670795 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1708_RS22870 (4670789) | 4670789..4671388 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P1708_RS22875 (4671579) | 4671579..4672382 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P1708_RS22880 (4672416) | 4672416..4673312 | - | 897 | WP_023197766.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T274828 WP_000558166.1 NZ_CP120343:4667734-4668045 [Salmonella enterica subsp. enterica serovar Paratyphi B]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16750.08 Da Isoelectric Point: 6.6451
>AT274828 WP_001259012.1 NZ_CP120343:4668042-4668488 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|