Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HTH(antitoxin)
Location 4665899..4666501 Replicon chromosome
Accession NZ_CP120343
Organism Salmonella enterica subsp. enterica serovar Paratyphi B strain PS_Mu_4_2021

Toxin (Protein)


Gene name higB Uniprot ID C0Q3J8
Locus tag P1708_RS22835 Protein ID WP_001159630.1
Coordinates 4666190..4666501 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag P1708_RS22830 Protein ID WP_000362050.1
Coordinates 4665899..4666189 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1708_RS22815 (4663392) 4663392..4664294 + 903 WP_000331361.1 formate dehydrogenase subunit beta -
P1708_RS22820 (4664291) 4664291..4664926 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
P1708_RS22825 (4664923) 4664923..4665852 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
P1708_RS22830 (4665899) 4665899..4666189 - 291 WP_000362050.1 DNA-binding transcriptional regulator Antitoxin
P1708_RS22835 (4666190) 4666190..4666501 - 312 WP_001159630.1 cytotoxic translational repressor of toxin-antitoxin stability system Toxin
P1708_RS22840 (4666719) 4666719..4667648 + 930 WP_021294279.1 alpha/beta hydrolase -
P1708_RS22845 (4667734) 4667734..4668045 + 312 WP_000558166.1 type II toxin-antitoxin system HigB family toxin -
P1708_RS22850 (4668042) 4668042..4668488 + 447 WP_001259012.1 type II toxin-antitoxin system HigA family antitoxin -
P1708_RS22855 (4668503) 4668503..4669444 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
P1708_RS22860 (4669489) 4669489..4669926 - 438 WP_001621365.1 D-aminoacyl-tRNA deacylase -
P1708_RS22865 (4669923) 4669923..4670795 - 873 WP_000921423.1 virulence factor BrkB family protein -
P1708_RS22870 (4670789) 4670789..4671388 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(36-85)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12326.27 Da        Isoelectric Point: 9.4460

>T274827 WP_001159630.1 NZ_CP120343:c4666501-4666190 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW

Download         Length: 312 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10971.59 Da        Isoelectric Point: 10.6525

>AT274827 WP_000362050.1 NZ_CP120343:c4666189-4665899 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9NS64

Antitoxin

Source ID Structure

References