Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacT-ataR/DUF1778(antitoxin)
Location 28613..29370 Replicon plasmid pESI
Accession NZ_CP120326
Organism Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_11_2021

Toxin (Protein)


Gene name tacT Uniprot ID A0A241PXX4
Locus tag P1704_RS23930 Protein ID WP_023994162.1
Coordinates 28888..29370 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID A0A727Z1I8
Locus tag P1704_RS23925 Protein ID WP_001195098.1
Coordinates 28613..28897 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1704_RS23880 (P1704_23880) 24454..24600 - 147 Protein_20 IS66 family insertion sequence element accessory protein TnpB -
P1704_RS23885 (P1704_23885) 24587..24916 - 330 WP_023994169.1 hypothetical protein -
P1704_RS23890 (P1704_23890) 25040..25893 + 854 Protein_22 site-specific tyrosine recombinase XerC -
P1704_RS23895 (P1704_23895) 25862..26149 + 288 WP_031619580.1 damage-inducible protein J -
P1704_RS23900 (P1704_23900) 26146..26451 + 306 WP_023994167.1 type II toxin-antitoxin system RelE/ParE family toxin -
P1704_RS23905 (P1704_23905) 27201..27464 + 264 WP_023994165.1 DUF977 family protein -
P1704_RS23910 (P1704_23910) 27490..27825 + 336 WP_023994164.1 hypothetical protein -
P1704_RS23915 (P1704_23915) 28047..28244 - 198 Protein_27 PIN domain-containing protein -
P1704_RS23920 (P1704_23920) 28368..28457 + 90 WP_071790431.1 helix-turn-helix domain-containing protein -
P1704_RS23925 (P1704_23925) 28613..28897 + 285 WP_001195098.1 DUF1778 domain-containing protein Antitoxin
P1704_RS23930 (P1704_23930) 28888..29370 + 483 WP_023994162.1 GNAT family N-acetyltransferase Toxin
P1704_RS23935 (P1704_23935) 29685..30111 + 427 Protein_31 transposase -
P1704_RS23940 (P1704_23940) 30428..30637 + 210 WP_023994160.1 hemolysin expression modulator Hha -
P1704_RS23945 (P1704_23945) 30711..31063 - 353 Protein_33 transposase -
P1704_RS23950 (P1704_23950) 31290..32263 + 974 Protein_34 IS256 family transposase -
P1704_RS23955 (P1704_23955) 32265..32507 + 243 WP_023994156.1 hypothetical protein -
P1704_RS23960 (P1704_23960) 32578..33534 + 957 WP_023994155.1 Rpn family recombination-promoting nuclease/putative transposase -
P1704_RS23965 (P1704_23965) 33593..33805 + 213 WP_023994154.1 hypothetical protein -
P1704_RS23970 (P1704_23970) 33847..34098 - 252 WP_023994153.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) / dfrA14 faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..285076 285076
- inside IScluster/Tn - - 23158..35662 12504


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(31-149)

Antitoxin

Vibrio phage ICP1, Orf50

(13-88)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17971.54 Da        Isoelectric Point: 6.8521

>T274679 WP_023994162.1 NZ_CP120326:28888-29370 [Salmonella enterica subsp. enterica serovar Muenchen]
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI

Download         Length: 483 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10964.52 Da        Isoelectric Point: 9.6539

>AT274679 WP_001195098.1 NZ_CP120326:28613-28897 [Salmonella enterica subsp. enterica serovar Muenchen]
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A241PXX4

Antitoxin

Source ID Structure
AlphaFold DB A0A727Z1I8

References