Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 17580..18105 | Replicon | plasmid p1 |
| Accession | NZ_CP120319 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_2_2022 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | I3W3D5 |
| Locus tag | P1703_RS23130 | Protein ID | WP_001159863.1 |
| Coordinates | 17800..18105 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7S5D0 |
| Locus tag | P1703_RS23125 | Protein ID | WP_000813641.1 |
| Coordinates | 17580..17798 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1703_RS23095 (P1703_23095) | 13194..13580 | + | 387 | WP_000751876.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| P1703_RS23100 (P1703_23100) | 13633..13752 | + | 120 | Protein_17 | recombinase | - |
| P1703_RS23105 (P1703_23105) | 14121..15110 | - | 990 | WP_000461382.1 | RepB family plasmid replication initiator protein | - |
| P1703_RS23110 (P1703_23110) | 15604..15899 | - | 296 | Protein_19 | cytoplasmic protein | - |
| P1703_RS23115 (P1703_23115) | 15911..16339 | + | 429 | Protein_20 | hypothetical protein | - |
| P1703_RS23120 (P1703_23120) | 16383..16904 | - | 522 | WP_077681952.1 | hypothetical protein | - |
| P1703_RS23125 (P1703_23125) | 17580..17798 | + | 219 | WP_000813641.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| P1703_RS23130 (P1703_23130) | 17800..18105 | + | 306 | WP_001159863.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| P1703_RS23135 (P1703_23135) | 18107..18397 | + | 291 | WP_025375060.1 | hypothetical protein | - |
| P1703_RS23140 (P1703_23140) | 18394..18915 | + | 522 | WP_065622004.1 | cytoplasmic protein | - |
| P1703_RS23145 (P1703_23145) | 18950..19732 | + | 783 | WP_000082169.1 | site-specific integrase | - |
| P1703_RS23150 (P1703_23150) | 19741..20454 | + | 714 | WP_000545756.1 | EAL domain-containing protein | - |
| P1703_RS23155 (P1703_23155) | 20479..20967 | + | 489 | WP_001075507.1 | CaiF/GrlA family transcriptional regulator | - |
| P1703_RS23160 (P1703_23160) | 20961..21446 | + | 486 | WP_000905606.1 | membrane protein | - |
| P1703_RS23165 (P1703_23165) | 21723..22010 | - | 288 | WP_071530243.1 | hypothetical protein | - |
| P1703_RS23170 (P1703_23170) | 22166..22726 | + | 561 | WP_000900095.1 | inverse autotransporter beta domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | rck / pefD / pefC / pefA / pefB / fdeC / spvC / spvB | 1..59372 | 59372 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11587.48 Da Isoelectric Point: 6.9787
>T274641 WP_001159863.1 NZ_CP120319:17800-18105 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | I3W3D5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656ICA6 |