Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 223911..224175 | Replicon | plasmid p508879 |
| Accession | NZ_CP119985 | ||
| Organism | Salmonella enterica strain CRIN508879 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | P2W29_RS24020 | Protein ID | WP_001387489.1 |
| Coordinates | 223911..224063 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 224115..224175 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2W29_RS23990 (219177) | 219177..221345 | + | 2169 | WP_058649949.1 | DotA/TraY family protein | - |
| P2W29_RS23995 (221416) | 221416..222078 | + | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| P2W29_RS24000 (222150) | 222150..222359 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| P2W29_RS24005 (222751) | 222751..222927 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| P2W29_RS24010 (222992) | 222992..223087 | - | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| P2W29_RS24015 (223588) | 223588..223839 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| P2W29_RS24020 (223911) | 223911..224063 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - (224115) | 224115..224175 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (224115) | 224115..224175 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (224115) | 224115..224175 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (224115) | 224115..224175 | + | 61 | NuclAT_0 | - | Antitoxin |
| P2W29_RS24025 (224690) | 224690..225469 | + | 780 | WP_275450201.1 | protein FinQ | - |
| P2W29_RS24030 (225776) | 225776..226984 | + | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
| P2W29_RS24035 (227003) | 227003..228073 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) / blaCTX-M-65 / fosA3 / floR / aph(4)-Ia / aac(3)-IVa / aph(3')-Ia | faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..315489 | 315489 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T274558 WP_001387489.1 NZ_CP119985:c224063-223911 [Salmonella enterica]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT274558 NZ_CP119985:224115-224175 [Salmonella enterica]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|