Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3617343..3617947 | Replicon | chromosome |
| Accession | NZ_CP119869 | ||
| Organism | Methylosinus trichosporium OB3b | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A1A6FMI3 |
| Locus tag | P3C36_RS17340 | Protein ID | WP_003612979.1 |
| Coordinates | 3617630..3617947 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1A6FMG2 |
| Locus tag | P3C36_RS17335 | Protein ID | WP_003612976.1 |
| Coordinates | 3617343..3617633 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3C36_RS17300 | 3612664..3612951 | - | 288 | WP_024749487.1 | co-chaperone GroES | - |
| P3C36_RS17305 | 3613242..3613736 | - | 495 | WP_003612966.1 | peptidoglycan-binding protein LysM | - |
| P3C36_RS17310 | 3613860..3614375 | - | 516 | WP_024749488.1 | YchJ family protein | - |
| P3C36_RS17315 | 3614584..3615843 | - | 1260 | WP_003612971.1 | cytochrome c peroxidase | - |
| P3C36_RS17320 | 3615959..3616459 | - | 501 | WP_003612972.1 | DUF2165 domain-containing protein | - |
| P3C36_RS17325 | 3616615..3616902 | + | 288 | WP_003612973.1 | YciI family protein | - |
| P3C36_RS17330 | 3616902..3617312 | + | 411 | WP_003612974.1 | EVE domain-containing protein | - |
| P3C36_RS17335 | 3617343..3617633 | - | 291 | WP_003612976.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P3C36_RS17340 | 3617630..3617947 | - | 318 | WP_003612979.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P3C36_RS17345 | 3618132..3619094 | + | 963 | WP_003612980.1 | malate dehydrogenase | - |
| P3C36_RS17350 | 3619171..3620370 | + | 1200 | WP_003612982.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| P3C36_RS17355 | 3620517..3622322 | + | 1806 | WP_099831827.1 | tetratricopeptide repeat protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12151.32 Da Isoelectric Point: 10.9010
>T274482 WP_003612979.1 NZ_CP119869:c3617947-3617630 [Methylosinus trichosporium OB3b]
MWSVEYLPAAAEEEAALPIEMQARLARMLDVIRRAGLTNLPRDWVKPLEGKLWELRITGKDGVARAIYVTAEGRRVVIVR
IFVKKTQKTPRRELELARRRAKEVE
MWSVEYLPAAAEEEAALPIEMQARLARMLDVIRRAGLTNLPRDWVKPLEGKLWELRITGKDGVARAIYVTAEGRRVVIVR
IFVKKTQKTPRRELELARRRAKEVE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1A6FMI3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1A6FMG2 |