Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 627378..628060 | Replicon | chromosome |
| Accession | NZ_CP119869 | ||
| Organism | Methylosinus trichosporium OB3b | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1A6FQN5 |
| Locus tag | P3C36_RS02895 | Protein ID | WP_003612262.1 |
| Coordinates | 627378..627788 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | P3C36_RS02900 | Protein ID | WP_003612263.1 |
| Coordinates | 627797..628060 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3C36_RS02875 | 623172..624110 | + | 939 | WP_003612258.1 | outer membrane beta-barrel protein | - |
| P3C36_RS02880 | 624180..625289 | + | 1110 | WP_003612259.1 | helix-turn-helix transcriptional regulator | - |
| P3C36_RS02885 | 625379..626510 | + | 1132 | WP_099831788.1 | peptide chain release factor 2 | - |
| P3C36_RS02890 | 626851..627183 | + | 333 | WP_003612261.1 | hypothetical protein | - |
| P3C36_RS02895 | 627378..627788 | - | 411 | WP_003612262.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P3C36_RS02900 | 627797..628060 | - | 264 | WP_003612263.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| P3C36_RS02905 | 628133..629989 | - | 1857 | WP_003612264.1 | cation:proton antiporter | - |
| P3C36_RS02910 | 630110..630511 | - | 402 | WP_003612265.1 | DUF3775 domain-containing protein | - |
| P3C36_RS02915 | 630588..631160 | - | 573 | WP_003612266.1 | isochorismatase family protein | - |
| P3C36_RS02920 | 632163..632390 | - | 228 | WP_283472095.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14966.38 Da Isoelectric Point: 6.7211
>T274477 WP_003612262.1 NZ_CP119869:c627788-627378 [Methylosinus trichosporium OB3b]
MFFLDTNVVIAVMTRRAPHLVARIEAELAHGTPLLLSTIVLYELEYGACKSAHPERNLARIGDFLVSVAAIVPLDVEDAR
EAGDIRAFLEAKGTPIGPYDVLIAAQARRRRIALVTGNRREFDRVPGLVMTDWTAA
MFFLDTNVVIAVMTRRAPHLVARIEAELAHGTPLLLSTIVLYELEYGACKSAHPERNLARIGDFLVSVAAIVPLDVEDAR
EAGDIRAFLEAKGTPIGPYDVLIAAQARRRRIALVTGNRREFDRVPGLVMTDWTAA
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|