Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 1185937..1186477 | Replicon | chromosome |
| Accession | NZ_CP119766 | ||
| Organism | Flavobacterium sp. CJ75 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | P2W65_RS05395 | Protein ID | WP_289664003.1 |
| Coordinates | 1186181..1186477 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | P2W65_RS05390 | Protein ID | WP_289664001.1 |
| Coordinates | 1185937..1186191 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2W65_RS05370 | 1181947..1183344 | - | 1398 | WP_289663992.1 | glycosyl hydrolase family 8 | - |
| P2W65_RS05375 | 1183446..1183625 | - | 180 | WP_008465789.1 | twin-arginine translocase TatA/TatE family subunit | - |
| P2W65_RS05380 | 1183840..1184343 | + | 504 | WP_289663997.1 | peptidase | - |
| P2W65_RS05385 | 1184354..1185838 | + | 1485 | WP_289663999.1 | GH3 auxin-responsive promoter family protein | - |
| P2W65_RS05390 | 1185937..1186191 | + | 255 | WP_289664001.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| P2W65_RS05395 | 1186181..1186477 | + | 297 | WP_289664003.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P2W65_RS05400 | 1186544..1188223 | + | 1680 | WP_289664004.1 | hypothetical protein | - |
| P2W65_RS05405 | 1188233..1189219 | + | 987 | WP_289664006.1 | hypothetical protein | - |
| P2W65_RS05410 | 1189227..1190528 | + | 1302 | WP_289664007.1 | MATE family efflux transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11930.87 Da Isoelectric Point: 8.0401
>T274442 WP_289664003.1 NZ_CP119766:1186181-1186477 [Flavobacterium sp. CJ75]
MNYKISIEASYDLEKIWLYTFDTWSAEQADRYLKLILDEIEYLCLKPNSGKDFSHIRKGYFRTKVKSHLIFYKINIKQNE
IEIIRVLHQMMDIENHLK
MNYKISIEASYDLEKIWLYTFDTWSAEQADRYLKLILDEIEYLCLKPNSGKDFSHIRKGYFRTKVKSHLIFYKINIKQNE
IEIIRVLHQMMDIENHLK
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|