Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1303033..1303653 | Replicon | chromosome |
| Accession | NZ_CP119754 | ||
| Organism | Superficieibacter sp. HKU1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | - |
| Locus tag | P0H77_RS06260 | Protein ID | WP_176917457.1 |
| Coordinates | 1303033..1303251 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | P0H77_RS06265 | Protein ID | WP_276164054.1 |
| Coordinates | 1303279..1303653 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0H77_RS06230 (P0H77_06235) | 1299109..1299369 | + | 261 | WP_276164049.1 | type B 50S ribosomal protein L31 | - |
| P0H77_RS06235 (P0H77_06240) | 1299373..1299513 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| P0H77_RS06240 (P0H77_06245) | 1299510..1300211 | - | 702 | WP_276165059.1 | GNAT family protein | - |
| P0H77_RS06245 (P0H77_06250) | 1300317..1301774 | + | 1458 | WP_276164051.1 | PLP-dependent aminotransferase family protein | - |
| P0H77_RS06250 (P0H77_06255) | 1301734..1302213 | - | 480 | WP_276164052.1 | YlaC family protein | - |
| P0H77_RS06255 (P0H77_06260) | 1302314..1302871 | - | 558 | WP_276164053.1 | maltose O-acetyltransferase | - |
| P0H77_RS06260 (P0H77_06265) | 1303033..1303251 | - | 219 | WP_176917457.1 | HHA domain-containing protein | Toxin |
| P0H77_RS06265 (P0H77_06270) | 1303279..1303653 | - | 375 | WP_276164054.1 | Hha toxicity modulator TomB | Antitoxin |
| P0H77_RS06270 (P0H77_06275) | 1304066..1307212 | - | 3147 | WP_276164055.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| P0H77_RS06275 (P0H77_06280) | 1307235..1308428 | - | 1194 | WP_276164056.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.01 Da Isoelectric Point: 7.9906
>T274428 WP_176917457.1 NZ_CP119754:c1303251-1303033 [Superficieibacter sp. HKU1]
MTDKALTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELVVFYSAADHRLAELTMNKLYDKIPPSVWQFIR
MTDKALTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELVVFYSAADHRLAELTMNKLYDKIPPSVWQFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14464.18 Da Isoelectric Point: 4.6598
>AT274428 WP_276164054.1 NZ_CP119754:c1303653-1303279 [Superficieibacter sp. HKU1]
MDEYSPKRHDIAQLKFLCENLYHDCIANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNNLVMQIDEYL
DDTFMLFSNYGISTQDLQKWRKSGNNLFHCFVNVSQANPARLSC
MDEYSPKRHDIAQLKFLCENLYHDCIANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNNLVMQIDEYL
DDTFMLFSNYGISTQDLQKWRKSGNNLFHCFVNVSQANPARLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|