Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 361981..362567 Replicon chromosome
Accession NZ_CP119754
Organism Superficieibacter sp. HKU1

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag P0H77_RS01725 Protein ID WP_276161778.1
Coordinates 362199..362567 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag P0H77_RS01720 Protein ID WP_276161769.1
Coordinates 361981..362202 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0H77_RS01695 (P0H77_01695) 357056..358165 + 1110 WP_276161734.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
P0H77_RS01700 (P0H77_01700) 358214..359140 + 927 WP_176919434.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P0H77_RS01705 (P0H77_01705) 359137..360414 + 1278 WP_276161746.1 branched chain amino acid ABC transporter permease LivM -
P0H77_RS01710 (P0H77_01710) 360411..361178 + 768 WP_176919432.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P0H77_RS01715 (P0H77_01715) 361180..361893 + 714 WP_276161760.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P0H77_RS01720 (P0H77_01720) 361981..362202 + 222 WP_276161769.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P0H77_RS01725 (P0H77_01725) 362199..362567 + 369 WP_276161778.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P0H77_RS01730 (P0H77_01730) 362736..364052 + 1317 WP_276161786.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P0H77_RS01735 (P0H77_01735) 364154..365041 + 888 WP_276161794.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P0H77_RS01740 (P0H77_01740) 365038..365883 + 846 WP_276161799.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P0H77_RS01745 (P0H77_01745) 365885..366958 + 1074 WP_276161806.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 359137..367698 8561


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13299.45 Da        Isoelectric Point: 7.1998

>T274427 WP_276161778.1 NZ_CP119754:362199-362567 [Superficieibacter sp. HKU1]
MTLQLISAEEIVSFHDKLLSVTPGVPGMPDPGRAEALLYRVLNKYDYEGISGLWNLAAMYLLAISRGHIFNDGNKRTALF
IALLFLKRNGVSLPANPAYVELTVDAAAGRLSLEEIAGRLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8137.30 Da        Isoelectric Point: 7.0113

>AT274427 WP_276161769.1 NZ_CP119754:361981-362202 [Superficieibacter sp. HKU1]
MRTINYSEARQNLAAALETAVTGTPVTITRRGRKPAVIISAEEFERYQTAKLDAEFAAIMMVHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References