Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
Location | 324116..324879 | Replicon | chromosome |
Accession | NZ_CP119754 | ||
Organism | Superficieibacter sp. HKU1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | P0H77_RS01545 | Protein ID | WP_276161552.1 |
Coordinates | 324403..324879 (+) | Length | 159 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | P0H77_RS01540 | Protein ID | WP_276161546.1 |
Coordinates | 324116..324412 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0H77_RS01515 (P0H77_01515) | 320475..321668 | + | 1194 | WP_276161514.1 | NAD(P)/FAD-dependent oxidoreductase | - |
P0H77_RS01520 (P0H77_01520) | 321907..322239 | + | 333 | WP_276161519.1 | DUF1971 domain-containing protein | - |
P0H77_RS01525 (P0H77_01525) | 322250..322588 | + | 339 | WP_276161523.1 | DUF1869 domain-containing protein | - |
P0H77_RS01530 (P0H77_01530) | 322612..322968 | + | 357 | WP_276161529.1 | DUF1971 domain-containing protein | - |
P0H77_RS01535 (P0H77_01535) | 323140..323934 | - | 795 | WP_276161537.1 | SDR family oxidoreductase | - |
P0H77_RS01540 (P0H77_01540) | 324116..324412 | + | 297 | WP_276161546.1 | DUF1778 domain-containing protein | Antitoxin |
P0H77_RS01545 (P0H77_01545) | 324403..324879 | + | 477 | WP_276161552.1 | GNAT family N-acetyltransferase | Toxin |
P0H77_RS01550 (P0H77_01550) | 324886..325284 | - | 399 | WP_276161559.1 | nickel-responsive transcriptional regulator NikR | - |
P0H77_RS01555 (P0H77_01555) | 325297..326073 | - | 777 | WP_276161564.1 | nickel import ATP-binding protein NikE | - |
P0H77_RS01560 (P0H77_01560) | 326070..326834 | - | 765 | WP_276161567.1 | nickel import ATP-binding protein NikD | - |
P0H77_RS01565 (P0H77_01565) | 326834..327667 | - | 834 | WP_276161571.1 | nickel ABC transporter permease subunit NikC | - |
P0H77_RS01570 (P0H77_01570) | 327664..328608 | - | 945 | WP_276161578.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 17908.72 Da Isoelectric Point: 8.7215
>T274425 WP_276161552.1 NZ_CP119754:324403-324879 [Superficieibacter sp. HKU1]
MEVTTPKILTDTHVMTDFCCGNSVLDDWLMRRALKKQALNASRTFVTCESGTRNVVGYYSLASGSVTHHAVPRGLRQNMP
EPIPVILLGRLAVDQRYQGQDMGKWLLNDVVNRVINVAEQIGVKAMMVHAINEDARRFYKHFGFVQSVIAEDTLFWRL
MEVTTPKILTDTHVMTDFCCGNSVLDDWLMRRALKKQALNASRTFVTCESGTRNVVGYYSLASGSVTHHAVPRGLRQNMP
EPIPVILLGRLAVDQRYQGQDMGKWLLNDVVNRVINVAEQIGVKAMMVHAINEDARRFYKHFGFVQSVIAEDTLFWRL
Download Length: 477 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|