Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
Location | 123878..124527 | Replicon | chromosome |
Accession | NZ_CP119754 | ||
Organism | Superficieibacter sp. HKU1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P0H77_RS00615 | Protein ID | WP_276160945.1 |
Coordinates | 124186..124527 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P0H77_RS00610 | Protein ID | WP_276160944.1 |
Coordinates | 123878..124189 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0H77_RS00590 (P0H77_00590) | 119460..120971 | - | 1512 | WP_276160940.1 | glycerol kinase GlpK | - |
P0H77_RS00595 (P0H77_00595) | 120994..121839 | - | 846 | WP_276160941.1 | MIP/aquaporin family protein | - |
P0H77_RS00600 (P0H77_00600) | 122273..122512 | + | 240 | WP_103676369.1 | septal ring assembly protein ZapB | - |
P0H77_RS00605 (P0H77_00605) | 122656..123645 | + | 990 | WP_276160942.1 | sulfate ABC transporter substrate-binding protein | - |
P0H77_RS00610 (P0H77_00610) | 123878..124189 | - | 312 | WP_276160944.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
P0H77_RS00615 (P0H77_00615) | 124186..124527 | - | 342 | WP_276160945.1 | toxin | Toxin |
P0H77_RS00620 (P0H77_00620) | 124776..125555 | + | 780 | WP_276160947.1 | CDP-diacylglycerol diphosphatase | - |
P0H77_RS00625 (P0H77_00625) | 125578..127170 | - | 1593 | WP_276160949.1 | autoinducer-2 kinase | - |
P0H77_RS00630 (P0H77_00630) | 127256..128221 | - | 966 | WP_276160951.1 | transcriptional regulator LsrR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13502.43 Da Isoelectric Point: 9.7093
>T274424 WP_276160945.1 NZ_CP119754:c124527-124186 [Superficieibacter sp. HKU1]
MDALFIELPPFERHRAEYFSDEEFRAFQQFLLKNPTCGDVIPDAGGLRKVRFLDSRRNKGKRGGIRVIYYWYLEKSHFLL
FTLYDKDQLDDLTTQQRNVLRQLLEQAKQRGKS
MDALFIELPPFERHRAEYFSDEEFRAFQQFLLKNPTCGDVIPDAGGLRKVRFLDSRRNKGKRGGIRVIYYWYLEKSHFLL
FTLYDKDQLDDLTTQQRNVLRQLLEQAKQRGKS
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|