Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 8702..9345 Replicon plasmid pE32-3
Accession NZ_CP119733
Organism Escherichia coli strain E32

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag P1J21_RS26155 Protein ID WP_001034046.1
Coordinates 8702..9118 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag P1J21_RS26160 Protein ID WP_001261278.1
Coordinates 9115..9345 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J21_RS26125 (P1J21_26125) 4181..4486 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
P1J21_RS26130 (P1J21_26130) 4488..4706 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
P1J21_RS26135 (P1J21_26135) 5688..5819 + 132 Protein_8 transposase -
P1J21_RS26140 (P1J21_26140) 5867..6052 + 186 WP_032353630.1 hypothetical protein -
P1J21_RS26145 (P1J21_26145) 6084..6536 - 453 WP_032353631.1 acyltransferase -
P1J21_RS26155 (P1J21_26155) 8702..9118 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
P1J21_RS26160 (P1J21_26160) 9115..9345 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P1J21_RS26165 (P1J21_26165) 9530..11017 + 1488 Protein_14 IncI1-type relaxase NikB -
P1J21_RS26170 (P1J21_26170) 11402..11791 + 390 WP_045146805.1 cytochrome b562 -
P1J21_RS26175 (P1J21_26175) 12022..12719 + 698 WP_225877546.1 IS1-like element IS1A family transposase -
P1J21_RS26180 (P1J21_26180) 12901..13764 + 864 WP_021534910.1 endonuclease/exonuclease/phosphatase family protein -
P1J21_RS26185 (P1J21_26185) 14024..14218 - 195 Protein_18 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..129739 129739
- inside IScluster/Tn - - 5688..49340 43652


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T274327 WP_001034046.1 NZ_CP119733:c9118-8702 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT274327 WP_001261278.1 NZ_CP119733:c9345-9115 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References