Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3677886..3678108 | Replicon | chromosome |
| Accession | NC_017638 | ||
| Organism | Escherichia coli DH1 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | ECDH1ME8569_RS18165 | Protein ID | WP_000141634.1 |
| Coordinates | 3677886..3677993 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3678042..3678108 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECDH1ME8569_RS18140 (ECDH1ME8569_3413) | 3673139..3673891 | - | 753 | Protein_3465 | cellulose biosynthesis protein BcsQ | - |
| ECDH1ME8569_RS18145 (ECDH1ME8569_3414) | 3673903..3674091 | - | 189 | WP_001063318.1 | YhjR family protein | - |
| ECDH1ME8569_RS18150 (ECDH1ME8569_3415) | 3674364..3675935 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
| ECDH1ME8569_RS18155 (ECDH1ME8569_3416) | 3675932..3676123 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| ECDH1ME8569_RS18160 (ECDH1ME8569_3417) | 3676120..3677799 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| ECDH1ME8569_RS18165 | 3677886..3677993 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| - | 3678042..3678108 | + | 67 | - | - | Antitoxin |
| ECDH1ME8569_RS18175 (ECDH1ME8569_3419) | 3678469..3679740 | + | 1272 | WP_001295225.1 | transporter | - |
| ECDH1ME8569_RS18180 (ECDH1ME8569_3420) | 3679770..3680774 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| ECDH1ME8569_RS18185 (ECDH1ME8569_3421) | 3680771..3681754 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| ECDH1ME8569_RS18190 (ECDH1ME8569_3422) | 3681765..3682667 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T27422 WP_000141634.1 NC_017638:c3677993-3677886 [Escherichia coli DH1]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T27422 NC_017638:c3677993-3677886 [Escherichia coli DH1]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT27422 NC_017638:3678042-3678108 [Escherichia coli DH1]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|