Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4013212..4014010 Replicon chromosome
Accession NZ_CP119400
Organism Escherichia coli strain MRE162 substr. NOR

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X1M0U2
Locus tag PX809_RS19555 Protein ID WP_000854919.1
Coordinates 4013212..4013589 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEZ5
Locus tag PX809_RS19560 Protein ID WP_001285608.1
Coordinates 4013636..4014010 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PX809_RS19520 (4008425) 4008425..4009531 + 1107 WP_001353974.1 N-acetylneuraminate epimerase -
PX809_RS19525 (4009596) 4009596..4010576 + 981 WP_001295601.1 sialate O-acetylesterase -
PX809_RS19530 (4010584) 4010584..4011234 - 651 WP_001037966.1 HNH endonuclease -
PX809_RS19535 (4011371) 4011371..4011514 + 144 Protein_3817 HNH endonuclease -
PX809_RS19540 (4012282) 4012282..4012425 - 144 Protein_3818 hypothetical protein -
PX809_RS19545 (4012510) 4012510..4012707 - 198 WP_001327226.1 DUF957 domain-containing protein -
PX809_RS19550 (4012727) 4012727..4013215 - 489 WP_000777664.1 DUF5983 family protein -
PX809_RS19555 (4013212) 4013212..4013589 - 378 WP_000854919.1 TA system toxin CbtA family protein Toxin
PX809_RS19560 (4013636) 4013636..4014010 - 375 WP_001285608.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PX809_RS19565 (4014090) 4014090..4014311 - 222 WP_000692350.1 DUF987 domain-containing protein -
PX809_RS19570 (4014398) 4014398..4014874 - 477 WP_001560293.1 RadC family protein -
PX809_RS19575 (4014889) 4014889..4015368 - 480 WP_000706978.1 antirestriction protein -
PX809_RS19580 (4015634) 4015634..4016452 - 819 WP_001175165.1 DUF932 domain-containing protein -
PX809_RS19585 (4016542) 4016542..4016775 - 234 WP_001278293.1 DUF905 family protein -
PX809_RS19590 (4016781) 4016781..4017458 - 678 WP_001097302.1 hypothetical protein -
PX809_RS19595 (4017606) 4017606..4018286 - 681 WP_001282921.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimE / fimB 4004560..4034111 29551


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14037.97 Da        Isoelectric Point: 7.9086

>T274072 WP_000854919.1 NZ_CP119400:c4013589-4013212 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13610.37 Da        Isoelectric Point: 5.5051

>AT274072 WP_001285608.1 NZ_CP119400:c4014010-4013636 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X1M0U2

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEZ5

References