Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3638956..3639754 | Replicon | chromosome |
| Accession | NZ_CP119400 | ||
| Organism | Escherichia coli strain MRE162 substr. NOR | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A166U9J9 |
| Locus tag | PX809_RS17720 | Protein ID | WP_000854695.1 |
| Coordinates | 3638956..3639333 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2U2UUE3 |
| Locus tag | PX809_RS17725 | Protein ID | WP_016243360.1 |
| Coordinates | 3639380..3639754 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX809_RS17695 (3634913) | 3634913..3635071 | - | 159 | WP_000788777.1 | hypothetical protein | - |
| PX809_RS17700 (3635917) | 3635917..3637236 | + | 1320 | WP_000144689.1 | site-specific integrase | - |
| PX809_RS17705 (3637329) | 3637329..3638177 | - | 849 | WP_001280536.1 | DUF4942 domain-containing protein | - |
| PX809_RS17710 (3638262) | 3638262..3638459 | - | 198 | WP_000839228.1 | DUF957 domain-containing protein | - |
| PX809_RS17715 (3638471) | 3638471..3638959 | - | 489 | WP_032083213.1 | DUF5983 family protein | - |
| PX809_RS17720 (3638956) | 3638956..3639333 | - | 378 | WP_000854695.1 | TA system toxin CbtA family protein | Toxin |
| PX809_RS17725 (3639380) | 3639380..3639754 | - | 375 | WP_016243360.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PX809_RS17730 (3639917) | 3639917..3640138 | - | 222 | WP_000692307.1 | DUF987 domain-containing protein | - |
| PX809_RS17735 (3640207) | 3640207..3640683 | - | 477 | WP_001186773.1 | RadC family protein | - |
| PX809_RS17740 (3640699) | 3640699..3641178 | - | 480 | WP_000860084.1 | antirestriction protein | - |
| PX809_RS17745 (3641260) | 3641260..3641847 | - | 588 | Protein_3470 | DUF932 domain-containing protein | - |
| PX809_RS17750 (3641842) | 3641842..3643048 | - | 1207 | Protein_3471 | autotransporter domain-containing protein | - |
| PX809_RS17755 (3643342) | 3643342..3644214 | - | 873 | WP_001069719.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 3597395..3641178 | 43783 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14062.03 Da Isoelectric Point: 7.7531
>T274069 WP_000854695.1 NZ_CP119400:c3639333-3638956 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPGAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13810.66 Da Isoelectric Point: 7.0266
>AT274069 WP_016243360.1 NZ_CP119400:c3639754-3639380 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A166U9J9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2U2UUE3 |