Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1940152..1940332 Replicon chromosome
Accession NZ_CP119338
Organism Staphylococcus aureus strain N09HSA11

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag P1A14_RS09405 Protein ID WP_001801861.1
Coordinates 1940152..1940247 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1940275..1940332 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1A14_RS09375 (P1A14_09375) 1936207..1936833 + 627 WP_000669028.1 hypothetical protein -
P1A14_RS09380 (P1A14_09380) 1936920..1937603 + 684 WP_000957233.1 exotoxin beta-grasp domain-containing protein -
P1A14_RS09385 (P1A14_09385) 1937630..1938382 + 753 WP_000764922.1 staphylococcal enterotoxin type 27 -
P1A14_RS09390 (P1A14_09390) 1938514..1939140 - 627 Protein_1851 ImmA/IrrE family metallo-endopeptidase -
P1A14_RS09395 (P1A14_09395) 1939254..1939700 - 447 WP_000747805.1 DUF1433 domain-containing protein -
P1A14_RS09400 (P1A14_09400) 1939876..1940007 - 132 WP_001808010.1 hypothetical protein -
P1A14_RS09405 (P1A14_09405) 1940152..1940247 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1940275..1940332 - 58 - - Antitoxin
P1A14_RS09410 (P1A14_09410) 1940370..1940468 + 99 Protein_1855 hypothetical protein -
P1A14_RS09415 (P1A14_09415) 1940898..1941557 - 660 WP_275593707.1 hypothetical protein -
P1A14_RS09420 (P1A14_09420) 1941602..1942774 - 1173 WP_000195429.1 IS256-like element IS256 family transposase -
P1A14_RS09425 (P1A14_09425) 1942871..1943359 - 489 WP_275593708.1 hypothetical protein -
P1A14_RS09430 (P1A14_09430) 1943421..1943930 - 510 WP_224684909.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk 1933648..1959718 26070


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T273981 WP_001801861.1 NZ_CP119338:1940152-1940247 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT273981 NZ_CP119338:c1940332-1940275 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References