Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 868577..869231 | Replicon | chromosome |
| Accession | NZ_CP118927 | ||
| Organism | Citrobacter koseri strain L2395 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A078LNB4 |
| Locus tag | PX343_RS04175 | Protein ID | WP_024130921.1 |
| Coordinates | 868824..869231 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A078LG12 |
| Locus tag | PX343_RS04170 | Protein ID | WP_024130922.1 |
| Coordinates | 868577..868843 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX343_RS04145 (PX343_04145) | 863721..865154 | - | 1434 | WP_115625884.1 | 6-phospho-beta-glucosidase BglA | - |
| PX343_RS04150 (PX343_04150) | 865275..866003 | - | 729 | WP_012135006.1 | MurR/RpiR family transcriptional regulator | - |
| PX343_RS04155 (PX343_04155) | 866056..866367 | + | 312 | WP_049008973.1 | N(4)-acetylcytidine aminohydrolase | - |
| PX343_RS04160 (PX343_04160) | 866529..867188 | + | 660 | WP_012135004.1 | hemolysin III family protein | - |
| PX343_RS04165 (PX343_04165) | 867340..868320 | - | 981 | WP_275055549.1 | tRNA-modifying protein YgfZ | - |
| PX343_RS04170 (PX343_04170) | 868577..868843 | + | 267 | WP_024130922.1 | FAD assembly factor SdhE | Antitoxin |
| PX343_RS04175 (PX343_04175) | 868824..869231 | + | 408 | WP_024130921.1 | protein YgfX | Toxin |
| PX343_RS04180 (PX343_04180) | 869329..869853 | - | 525 | WP_012134999.1 | flavodoxin FldB | - |
| PX343_RS04185 (PX343_04185) | 869957..870853 | + | 897 | WP_012134998.1 | site-specific tyrosine recombinase XerD | - |
| PX343_RS04190 (PX343_04190) | 870877..871590 | + | 714 | WP_049008968.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PX343_RS04195 (PX343_04195) | 871596..873329 | + | 1734 | WP_049008966.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15888.77 Da Isoelectric Point: 11.2845
>T273572 WP_024130921.1 NZ_CP118927:868824-869231 [Citrobacter koseri]
VVLWQSDLRVSWRAQWLSLLIHGLVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRINTRQGEIKLLMDGRLRWQGQ
DWTIQGPPWMLKTGMMLRLRADSGKRQHLWLAADSMDDAEWRDLRRLMLQQATQG
VVLWQSDLRVSWRAQWLSLLIHGLVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRINTRQGEIKLLMDGRLRWQGQ
DWTIQGPPWMLKTGMMLRLRADSGKRQHLWLAADSMDDAEWRDLRRLMLQQATQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A078LNB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A078LG12 |