Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 74629..75461 | Replicon | chromosome |
| Accession | NZ_CP118927 | ||
| Organism | Citrobacter koseri strain L2395 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0H2VCF5 |
| Locus tag | PX343_RS00345 | Protein ID | WP_000854681.1 |
| Coordinates | 74629..75006 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PX343_RS00350 | Protein ID | WP_088474659.1 |
| Coordinates | 75096..75461 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX343_RS00320 (PX343_00320) | 70813..71820 | - | 1008 | WP_115180953.1 | zinc-binding alcohol dehydrogenase family protein | - |
| PX343_RS00325 (PX343_00325) | 71932..72840 | + | 909 | WP_058668296.1 | LysR family transcriptional regulator | - |
| PX343_RS00330 (PX343_00330) | 73283..74125 | - | 843 | WP_096939511.1 | DUF4942 domain-containing protein | - |
| PX343_RS00335 (PX343_00335) | 74210..74407 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| PX343_RS00340 (PX343_00340) | 74435..74632 | - | 198 | Protein_67 | DUF5983 family protein | - |
| PX343_RS00345 (PX343_00345) | 74629..75006 | - | 378 | WP_000854681.1 | TA system toxin CbtA family protein | Toxin |
| PX343_RS00350 (PX343_00350) | 75096..75461 | - | 366 | WP_088474659.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PX343_RS00355 (PX343_00355) | 75539..75760 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| PX343_RS00360 (PX343_00360) | 75823..76299 | - | 477 | WP_001424026.1 | RadC family protein | - |
| PX343_RS00365 (PX343_00365) | 76315..76800 | - | 486 | WP_000206658.1 | antirestriction protein | - |
| PX343_RS00370 (PX343_00370) | 76892..77710 | - | 819 | WP_001234615.1 | DUF932 domain-containing protein | - |
| PX343_RS00375 (PX343_00375) | 77809..78042 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| PX343_RS00380 (PX343_00380) | 78048..78725 | - | 678 | WP_001097305.1 | hypothetical protein | - |
| PX343_RS00385 (PX343_00385) | 78873..79553 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13963.89 Da Isoelectric Point: 7.4348
>T273570 WP_000854681.1 NZ_CP118927:c75006-74629 [Citrobacter koseri]
MKTLPDTHIREASHCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTSHNYRTVNNITLGKHPEAKR
MKTLPDTHIREASHCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTSHNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|