Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 741874..742413 | Replicon | chromosome |
Accession | NZ_CP118776 | ||
Organism | Mammaliicoccus lentus strain 7074 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A178P0V5 |
Locus tag | PYH61_RS03715 | Protein ID | WP_016999692.1 |
Coordinates | 742042..742413 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A4Y9KBD3 |
Locus tag | PYH61_RS03710 | Protein ID | WP_016999693.1 |
Coordinates | 741874..742041 (+) | Length | 56 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYH61_RS03685 (PYH61_03685) | 737735..738214 | + | 480 | WP_282822110.1 | PH domain-containing protein | - |
PYH61_RS03690 (PYH61_03690) | 738204..739736 | + | 1533 | WP_103268922.1 | PH domain-containing protein | - |
PYH61_RS03695 (PYH61_03695) | 739726..740226 | + | 501 | WP_064204141.1 | PH domain-containing protein | - |
PYH61_RS03700 (PYH61_03700) | 740223..740591 | + | 369 | WP_064204140.1 | holo-ACP synthase | - |
PYH61_RS03705 (PYH61_03705) | 740639..741787 | + | 1149 | WP_103268921.1 | alanine racemase | - |
PYH61_RS03710 (PYH61_03710) | 741874..742041 | + | 168 | WP_016999693.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PYH61_RS03715 (PYH61_03715) | 742042..742413 | + | 372 | WP_016999692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PYH61_RS03720 (PYH61_03720) | 742517..743521 | + | 1005 | WP_064204137.1 | PP2C family protein-serine/threonine phosphatase | - |
PYH61_RS03725 (PYH61_03725) | 743594..743920 | + | 327 | WP_016999690.1 | anti-sigma factor antagonist | - |
PYH61_RS03730 (PYH61_03730) | 743922..744398 | + | 477 | WP_016999689.1 | anti-sigma B factor RsbW | - |
PYH61_RS03735 (PYH61_03735) | 744373..745143 | + | 771 | WP_103268920.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13662.79 Da Isoelectric Point: 9.8460
>T273439 WP_016999692.1 NZ_CP118776:742042-742413 [Mammaliicoccus lentus]
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDSAIAISLNLTLQYKFDTLGNT
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A178P0V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y9KBD3 |