Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 157177..157682 | Replicon | chromosome |
| Accession | NZ_CP118641 | ||
| Organism | Pseudomonas aeruginosa strain P23 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A069QL22 |
| Locus tag | PUL49_RS00715 | Protein ID | WP_003121619.1 |
| Coordinates | 157177..157458 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q9I707 |
| Locus tag | PUL49_RS00720 | Protein ID | WP_003112628.1 |
| Coordinates | 157455..157682 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUL49_RS00690 (PUL49_00690) | 152428..153777 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| PUL49_RS00695 (PUL49_00695) | 153826..154512 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| PUL49_RS00700 (PUL49_00700) | 154613..155347 | + | 735 | WP_043095998.1 | GntR family transcriptional regulator | - |
| PUL49_RS00705 (PUL49_00705) | 155527..155937 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| PUL49_RS00710 (PUL49_00710) | 155969..156877 | - | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
| PUL49_RS00715 (PUL49_00715) | 157177..157458 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PUL49_RS00720 (PUL49_00720) | 157455..157682 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PUL49_RS00725 (PUL49_00725) | 157858..158478 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| PUL49_RS00730 (PUL49_00730) | 158579..159079 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| PUL49_RS00735 (PUL49_00735) | 159152..159493 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| PUL49_RS00740 (PUL49_00740) | 159575..161002 | - | 1428 | WP_003083784.1 | GABA permease | - |
| PUL49_RS00745 (PUL49_00745) | 161171..162664 | - | 1494 | WP_043095997.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T273358 WP_003121619.1 NZ_CP118641:c157458-157177 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A069QL22 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6XRW | |
| AlphaFold DB | Q9I707 |