Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1910023..1910854 Replicon chromosome
Accession NZ_CP118601
Organism Escherichia coli strain NB4833

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag OU688_RS09125 Protein ID WP_000854814.1
Coordinates 1910023..1910397 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag OU688_RS09130 Protein ID WP_001285585.1
Coordinates 1910486..1910854 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OU688_RS09085 (1905419) 1905419..1906585 + 1167 WP_001442313.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
OU688_RS09090 (1906704) 1906704..1907177 + 474 WP_001105414.1 DNA gyrase inhibitor SbmC -
OU688_RS09095 (1907375) 1907375..1908433 + 1059 WP_001200905.1 FUSC family protein -
OU688_RS09100 (1908605) 1908605..1908934 + 330 WP_000450409.1 DUF496 family protein -
OU688_RS09105 (1909035) 1909035..1909169 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
OU688_RS09110 (1909271) 1909271..1909417 + 147 Protein_1782 transposase domain-containing protein -
OU688_RS09115 (1909706) 1909706..1909786 - 81 Protein_1783 hypothetical protein -
OU688_RS09120 (1909832) 1909832..1910026 - 195 WP_000988599.1 DUF5983 family protein -
OU688_RS09125 (1910023) 1910023..1910397 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
OU688_RS09130 (1910486) 1910486..1910854 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
OU688_RS09135 (1910928) 1910928..1911149 - 222 WP_000692323.1 DUF987 domain-containing protein -
OU688_RS09140 (1911212) 1911212..1911688 - 477 WP_001186773.1 RadC family protein -
OU688_RS09145 (1911704) 1911704..1912183 - 480 WP_000860076.1 antirestriction protein -
OU688_RS09150 (1912265) 1912265..1913086 - 822 WP_001234530.1 DUF932 domain-containing protein -
OU688_RS09155 (1913307) 1913307..1913717 - 411 WP_000846713.1 hypothetical protein -
OU688_RS09160 (1913733) 1913733..1914415 - 683 Protein_1792 hypothetical protein -
OU688_RS09165 (1914551) 1914551..1915621 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T273275 WP_000854814.1 NZ_CP118601:c1910397-1910023 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT273275 WP_001285585.1 NZ_CP118601:c1910854-1910486 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References