Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 1566338..1566885 | Replicon | chromosome |
| Accession | NZ_CP118576 | ||
| Organism | Vibrio harveyi strain fish1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A347UR19 |
| Locus tag | PWW27_RS07245 | Protein ID | WP_025548916.1 |
| Coordinates | 1566338..1566640 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0C1ZM65 |
| Locus tag | PWW27_RS07250 | Protein ID | WP_020196830.1 |
| Coordinates | 1566628..1566885 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWW27_RS07180 | 1561479..1561874 | - | 396 | WP_260262200.1 | GNAT family N-acetyltransferase | - |
| PWW27_RS07185 | 1561901..1561993 | - | 93 | WP_274886436.1 | DUF3265 domain-containing protein | - |
| PWW27_RS07190 | 1562031..1562309 | - | 279 | WP_274886437.1 | hypothetical protein | - |
| PWW27_RS07195 | 1562856..1562948 | - | 93 | WP_080765011.1 | DUF3265 domain-containing protein | - |
| PWW27_RS07200 | 1562963..1563367 | - | 405 | WP_274886438.1 | hypothetical protein | - |
| PWW27_RS07205 | 1563394..1563483 | - | 90 | WP_109170471.1 | DUF3265 domain-containing protein | - |
| PWW27_RS07210 | 1563510..1563890 | - | 381 | WP_274886439.1 | DUF4087 domain-containing protein | - |
| PWW27_RS07215 | 1564007..1564462 | - | 456 | WP_017191321.1 | GNAT family N-acetyltransferase | - |
| PWW27_RS07220 | 1564500..1564592 | - | 93 | WP_079386045.1 | DUF3265 domain-containing protein | - |
| PWW27_RS07225 | 1564607..1565542 | - | 936 | WP_025628297.1 | nucleoside 2-deoxyribosyltransferase | - |
| PWW27_RS07230 | 1565623..1565685 | - | 63 | Protein_1403 | DUF3265 domain-containing protein | - |
| PWW27_RS07235 | 1565697..1566116 | - | 420 | WP_077200592.1 | hypothetical protein | - |
| PWW27_RS07240 | 1566210..1566299 | - | 90 | WP_079755141.1 | DUF3265 domain-containing protein | - |
| PWW27_RS07245 | 1566338..1566640 | - | 303 | WP_025548916.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PWW27_RS07250 | 1566628..1566885 | - | 258 | WP_020196830.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PWW27_RS07255 | 1566968..1567097 | - | 130 | Protein_1408 | DUF3265 domain-containing protein | - |
| PWW27_RS07260 | 1567561..1567626 | - | 66 | Protein_1409 | DUF3265 domain-containing protein | - |
| PWW27_RS07265 | 1567637..1567846 | - | 210 | WP_050903701.1 | hypothetical protein | - |
| PWW27_RS07270 | 1568159..1568251 | - | 93 | WP_076007850.1 | DUF3265 domain-containing protein | - |
| PWW27_RS07275 | 1568266..1569705 | - | 1440 | WP_274886440.1 | protein kinase | - |
| PWW27_RS07280 | 1569761..1569890 | - | 130 | Protein_1413 | DUF3265 domain-containing protein | - |
| PWW27_RS07285 | 1570309..1570401 | - | 93 | WP_079749976.1 | DUF3265 domain-containing protein | - |
| PWW27_RS07290 | 1570440..1570940 | - | 501 | WP_053307058.1 | opioid growth factor receptor-related protein | - |
| PWW27_RS07295 | 1570989..1571081 | - | 93 | WP_072600976.1 | DUF3265 domain-containing protein | - |
| PWW27_RS07300 | 1571135..1571356 | - | 222 | WP_146255297.1 | hypothetical protein | - |
| PWW27_RS07305 | 1571621..1571713 | - | 93 | WP_005377014.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1522282..1580952 | 58670 | |
| - | inside | Integron | - | - | 1530652..1580952 | 50300 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11669.57 Da Isoelectric Point: 5.1765
>T273245 WP_025548916.1 NZ_CP118576:c1566640-1566338 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A347UR19 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C1ZM65 |