Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1566338..1566885 Replicon chromosome
Accession NZ_CP118576
Organism Vibrio harveyi strain fish1

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR19
Locus tag PWW27_RS07245 Protein ID WP_025548916.1
Coordinates 1566338..1566640 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0C1ZM65
Locus tag PWW27_RS07250 Protein ID WP_020196830.1
Coordinates 1566628..1566885 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWW27_RS07180 1561479..1561874 - 396 WP_260262200.1 GNAT family N-acetyltransferase -
PWW27_RS07185 1561901..1561993 - 93 WP_274886436.1 DUF3265 domain-containing protein -
PWW27_RS07190 1562031..1562309 - 279 WP_274886437.1 hypothetical protein -
PWW27_RS07195 1562856..1562948 - 93 WP_080765011.1 DUF3265 domain-containing protein -
PWW27_RS07200 1562963..1563367 - 405 WP_274886438.1 hypothetical protein -
PWW27_RS07205 1563394..1563483 - 90 WP_109170471.1 DUF3265 domain-containing protein -
PWW27_RS07210 1563510..1563890 - 381 WP_274886439.1 DUF4087 domain-containing protein -
PWW27_RS07215 1564007..1564462 - 456 WP_017191321.1 GNAT family N-acetyltransferase -
PWW27_RS07220 1564500..1564592 - 93 WP_079386045.1 DUF3265 domain-containing protein -
PWW27_RS07225 1564607..1565542 - 936 WP_025628297.1 nucleoside 2-deoxyribosyltransferase -
PWW27_RS07230 1565623..1565685 - 63 Protein_1403 DUF3265 domain-containing protein -
PWW27_RS07235 1565697..1566116 - 420 WP_077200592.1 hypothetical protein -
PWW27_RS07240 1566210..1566299 - 90 WP_079755141.1 DUF3265 domain-containing protein -
PWW27_RS07245 1566338..1566640 - 303 WP_025548916.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWW27_RS07250 1566628..1566885 - 258 WP_020196830.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWW27_RS07255 1566968..1567097 - 130 Protein_1408 DUF3265 domain-containing protein -
PWW27_RS07260 1567561..1567626 - 66 Protein_1409 DUF3265 domain-containing protein -
PWW27_RS07265 1567637..1567846 - 210 WP_050903701.1 hypothetical protein -
PWW27_RS07270 1568159..1568251 - 93 WP_076007850.1 DUF3265 domain-containing protein -
PWW27_RS07275 1568266..1569705 - 1440 WP_274886440.1 protein kinase -
PWW27_RS07280 1569761..1569890 - 130 Protein_1413 DUF3265 domain-containing protein -
PWW27_RS07285 1570309..1570401 - 93 WP_079749976.1 DUF3265 domain-containing protein -
PWW27_RS07290 1570440..1570940 - 501 WP_053307058.1 opioid growth factor receptor-related protein -
PWW27_RS07295 1570989..1571081 - 93 WP_072600976.1 DUF3265 domain-containing protein -
PWW27_RS07300 1571135..1571356 - 222 WP_146255297.1 hypothetical protein -
PWW27_RS07305 1571621..1571713 - 93 WP_005377014.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1522282..1580952 58670
- inside Integron - - 1530652..1580952 50300


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11669.57 Da        Isoelectric Point: 5.1765

>T273245 WP_025548916.1 NZ_CP118576:c1566640-1566338 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9605.15 Da        Isoelectric Point: 8.5338

>AT273245 WP_020196830.1 NZ_CP118576:c1566885-1566628 [Vibrio harveyi]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDKAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR19

Antitoxin

Source ID Structure
AlphaFold DB A0A0C1ZM65

References