Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 68832..69358 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP118553 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00206 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7R6HXL1 |
| Locus tag | PWP98_RS23945 | Protein ID | WP_015572079.1 |
| Coordinates | 69071..69358 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | PWP98_RS23940 | Protein ID | WP_000534858.1 |
| Coordinates | 68832..69071 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWP98_RS23910 (PWP98_23910) | 63905..64840 | - | 936 | WP_004118100.1 | GlxA family transcriptional regulator | - |
| PWP98_RS23915 (PWP98_23915) | 64851..66053 | - | 1203 | WP_015572077.1 | MFS transporter | - |
| PWP98_RS23920 (PWP98_23920) | 66093..66854 | - | 762 | WP_004118132.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| PWP98_RS23925 (PWP98_23925) | 66884..67699 | - | 816 | WP_032670836.1 | SDR family oxidoreductase | - |
| PWP98_RS23930 (PWP98_23930) | 68163..68483 | + | 321 | WP_004197483.1 | hypothetical protein | - |
| PWP98_RS23935 (PWP98_23935) | 68705..68807 | - | 103 | Protein_74 | hypothetical protein | - |
| PWP98_RS23940 (PWP98_23940) | 68832..69071 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| PWP98_RS23945 (PWP98_23945) | 69071..69358 | + | 288 | WP_015572079.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PWP98_RS23950 (PWP98_23950) | 69430..69588 | + | 159 | WP_013087178.1 | type I toxin-antitoxin system Hok family toxin | - |
| PWP98_RS23955 (PWP98_23955) | 70457..70831 | + | 375 | WP_049127080.1 | hypothetical protein | - |
| PWP98_RS23960 (PWP98_23960) | 70828..71175 | + | 348 | WP_045325353.1 | hypothetical protein | - |
| PWP98_RS23965 (PWP98_23965) | 71879..72172 | + | 294 | WP_032670838.1 | hypothetical protein | - |
| PWP98_RS23970 (PWP98_23970) | 72189..73010 | + | 822 | WP_015572081.1 | DUF932 domain-containing protein | - |
| PWP98_RS23975 (PWP98_23975) | 73039..73578 | - | 540 | WP_032664846.1 | lytic transglycosylase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..175470 | 175470 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11209.09 Da Isoelectric Point: 10.0714
>T273230 WP_015572079.1 NZ_CP118553:69071-69358 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKNKLAEVLESPRIDANKLRGMHDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKNKLAEVLESPRIDANKLRGMHDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4FXE | |
| PDB | 2KC8 | |
| PDB | 2K29 | |
| AlphaFold DB | A0A4V1CTS8 |