Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4829975..4830591 | Replicon | chromosome |
| Accession | NZ_CP118552 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00206 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PWP98_RS23175 | Protein ID | WP_017382676.1 |
| Coordinates | 4829975..4830346 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | PWP98_RS23180 | Protein ID | WP_015569912.1 |
| Coordinates | 4830349..4830591 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWP98_RS23160 (PWP98_23160) | 4827475..4828377 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| PWP98_RS23165 (PWP98_23165) | 4828374..4829009 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PWP98_RS23170 (PWP98_23170) | 4829006..4829935 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| PWP98_RS23175 (PWP98_23175) | 4829975..4830346 | - | 372 | WP_017382676.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PWP98_RS23180 (PWP98_23180) | 4830349..4830591 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PWP98_RS23185 (PWP98_23185) | 4830790..4831782 | + | 993 | WP_080347228.1 | alpha/beta hydrolase | - |
| PWP98_RS23190 (PWP98_23190) | 4831719..4832660 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| PWP98_RS23195 (PWP98_23195) | 4832705..4833142 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| PWP98_RS23200 (PWP98_23200) | 4833139..4834020 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| PWP98_RS23205 (PWP98_23205) | 4834014..4834613 | - | 600 | WP_017694048.1 | glucose-1-phosphatase | - |
| PWP98_RS23210 (PWP98_23210) | 4834732..4835532 | - | 801 | WP_047746063.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13737.88 Da Isoelectric Point: 6.4882
>T273229 WP_017382676.1 NZ_CP118552:c4830346-4829975 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|