Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 579314..579934 | Replicon | chromosome |
| Accession | NZ_CP118552 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00206 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | PWP98_RS02745 | Protein ID | WP_015571250.1 |
| Coordinates | 579314..579532 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | PWP98_RS02750 | Protein ID | WP_006809850.1 |
| Coordinates | 579560..579934 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWP98_RS02715 (PWP98_02715) | 575326..575586 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
| PWP98_RS02720 (PWP98_02720) | 575589..575729 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| PWP98_RS02725 (PWP98_02725) | 575726..576436 | - | 711 | WP_017383207.1 | GNAT family protein | - |
| PWP98_RS02730 (PWP98_02730) | 576538..577998 | + | 1461 | WP_058685706.1 | PLP-dependent aminotransferase family protein | - |
| PWP98_RS02735 (PWP98_02735) | 577970..578437 | - | 468 | WP_023296041.1 | YlaC family protein | - |
| PWP98_RS02740 (PWP98_02740) | 578554..579105 | - | 552 | WP_047746134.1 | maltose O-acetyltransferase | - |
| PWP98_RS02745 (PWP98_02745) | 579314..579532 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| PWP98_RS02750 (PWP98_02750) | 579560..579934 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| PWP98_RS02755 (PWP98_02755) | 580445..583591 | - | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PWP98_RS02760 (PWP98_02760) | 583614..584807 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T273220 WP_015571250.1 NZ_CP118552:c579532-579314 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT273220 WP_006809850.1 NZ_CP118552:c579934-579560 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |