Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 806361..807009 | Replicon | chromosome |
| Accession | NZ_CP118536 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain S7 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A715BCB4 |
| Locus tag | PWA19_RS03900 | Protein ID | WP_000244762.1 |
| Coordinates | 806361..806762 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | PWA19_RS03905 | Protein ID | WP_000351186.1 |
| Coordinates | 806743..807009 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA19_RS03880 (PWA19_03880) | 802290..804023 | - | 1734 | WP_000813396.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PWA19_RS03885 (PWA19_03885) | 804029..804742 | - | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PWA19_RS03890 (PWA19_03890) | 804766..805662 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| PWA19_RS03895 (PWA19_03895) | 805775..806296 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
| PWA19_RS03900 (PWA19_03900) | 806361..806762 | - | 402 | WP_000244762.1 | protein YgfX | Toxin |
| PWA19_RS03905 (PWA19_03905) | 806743..807009 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| PWA19_RS03910 (PWA19_03910) | 807259..808239 | + | 981 | WP_000874170.1 | tRNA-modifying protein YgfZ | - |
| PWA19_RS03915 (PWA19_03915) | 808355..809014 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
| PWA19_RS03920 (PWA19_03920) | 809178..809489 | - | 312 | WP_001182971.1 | N(4)-acetylcytidine aminohydrolase | - |
| PWA19_RS03925 (PWA19_03925) | 809648..811081 | + | 1434 | WP_001230148.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15773.75 Da Isoelectric Point: 10.7537
>T273151 WP_000244762.1 NZ_CP118536:c806762-806361 [Salmonella enterica subsp. enterica serovar Typhi]
VVLWQSDLRVSWRAQWISLLLHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPI
VVLWQSDLRVSWRAQWISLLLHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPI
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A715BCB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |