Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 309670..310219 Replicon chromosome
Accession NZ_CP118438
Organism Vibrio vulnificus strain 1908-10

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag PVE41_RS01515 Protein ID WP_039553850.1
Coordinates 309920..310219 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag PVE41_RS01510 Protein ID WP_039553847.1
Coordinates 309670..309912 (+) Length 81 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVE41_RS01465 (PVE41_01465) 304703..304894 - 192 WP_282500007.1 DUF3265 domain-containing protein -
PVE41_RS01470 (PVE41_01470) 304960..305928 + 969 WP_131069788.1 IS30-like element ISVa6 family transposase -
PVE41_RS01475 (PVE41_01475) 306425..306790 - 366 WP_176299820.1 hypothetical protein -
PVE41_RS01480 (PVE41_01480) 306863..306982 - 120 WP_282500197.1 DUF3265 domain-containing protein -
PVE41_RS01485 (PVE41_01485) 307000..307332 - 333 WP_282500198.1 RDD family protein -
PVE41_RS01490 (PVE41_01490) 308407..308577 - 171 WP_080933902.1 DUF3265 domain-containing protein -
PVE41_RS01495 (PVE41_01495) 308543..308995 - 453 WP_140254528.1 hypothetical protein -
PVE41_RS01500 (PVE41_01500) 309013..309113 - 101 Protein_299 DUF3265 domain-containing protein -
PVE41_RS01505 (PVE41_01505) 309145..309390 - 246 WP_045618311.1 Rho-binding antiterminator -
PVE41_RS01510 (PVE41_01510) 309670..309912 + 243 WP_039553847.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PVE41_RS01515 (PVE41_01515) 309920..310219 + 300 WP_039553850.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PVE41_RS01520 (PVE41_01520) 310265..310394 - 130 Protein_303 DUF3265 domain-containing protein -
PVE41_RS01525 (PVE41_01525) 310404..310949 - 546 WP_282500009.1 hypothetical protein -
PVE41_RS01530 (PVE41_01530) 311002..311349 - 348 WP_043920995.1 hypothetical protein -
PVE41_RS01535 (PVE41_01535) 311591..312181 - 591 WP_225509125.1 hypothetical protein -
PVE41_RS01540 (PVE41_01540) 312290..312367 - 78 Protein_307 DUF3265 domain-containing protein -
PVE41_RS01545 (PVE41_01545) 312361..312843 - 483 WP_258493135.1 tetratricopeptide repeat protein -
PVE41_RS01550 (PVE41_01550) 312864..312983 - 120 Protein_309 DUF3265 domain-containing protein -
PVE41_RS01555 (PVE41_01555) 313459..313866 - 408 WP_108678010.1 GFA family protein -
PVE41_RS01560 (PVE41_01560) 313912..314001 - 90 WP_079852034.1 DUF3265 domain-containing protein -
PVE41_RS01565 (PVE41_01565) 314019..314396 - 378 WP_017191301.1 hypothetical protein -
PVE41_RS01570 (PVE41_01570) 314406..314522 - 117 WP_282500199.1 DUF3265 domain-containing protein -
PVE41_RS01575 (PVE41_01575) 314540..314905 - 366 WP_176299820.1 hypothetical protein -
PVE41_RS01580 (PVE41_01580) 314978..315118 - 141 WP_282500200.1 DUF3265 domain-containing protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 251879..392377 140498
- inside Integron - - 296711..392377 95666


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 100 a.a.        Molecular weight: 11416.02 Da        Isoelectric Point: 9.6265

>T273126 WP_039553850.1 NZ_CP118438:309920-310219 [Vibrio vulnificus]
MQKNKYKLSNLAQSHLRKAKNYTVENFSELQWRNYKDTLLSGFQMLADNPGLGRSCDEIYPNGFYFPIGKHTAYFTKEDG
FILVVAVLGQSQLPQNHLK

Download         Length: 300 bp


Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9031.26 Da        Isoelectric Point: 5.6926

>AT273126 WP_039553847.1 NZ_CP118438:309670-309912 [Vibrio vulnificus]
MHTLTANDAKRNFGELLLSAQREPVKISKNSKDTVVVMSIRDFEELEAMKVEYLKHCFKSAKEDLNNGNAIDGESFLNSL

Download         Length: 243 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Source ID Structure

References