Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-YefM |
| Location | 309670..310219 | Replicon | chromosome |
| Accession | NZ_CP118438 | ||
| Organism | Vibrio vulnificus strain 1908-10 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | PVE41_RS01515 | Protein ID | WP_039553850.1 |
| Coordinates | 309920..310219 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | PVE41_RS01510 | Protein ID | WP_039553847.1 |
| Coordinates | 309670..309912 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVE41_RS01465 (PVE41_01465) | 304703..304894 | - | 192 | WP_282500007.1 | DUF3265 domain-containing protein | - |
| PVE41_RS01470 (PVE41_01470) | 304960..305928 | + | 969 | WP_131069788.1 | IS30-like element ISVa6 family transposase | - |
| PVE41_RS01475 (PVE41_01475) | 306425..306790 | - | 366 | WP_176299820.1 | hypothetical protein | - |
| PVE41_RS01480 (PVE41_01480) | 306863..306982 | - | 120 | WP_282500197.1 | DUF3265 domain-containing protein | - |
| PVE41_RS01485 (PVE41_01485) | 307000..307332 | - | 333 | WP_282500198.1 | RDD family protein | - |
| PVE41_RS01490 (PVE41_01490) | 308407..308577 | - | 171 | WP_080933902.1 | DUF3265 domain-containing protein | - |
| PVE41_RS01495 (PVE41_01495) | 308543..308995 | - | 453 | WP_140254528.1 | hypothetical protein | - |
| PVE41_RS01500 (PVE41_01500) | 309013..309113 | - | 101 | Protein_299 | DUF3265 domain-containing protein | - |
| PVE41_RS01505 (PVE41_01505) | 309145..309390 | - | 246 | WP_045618311.1 | Rho-binding antiterminator | - |
| PVE41_RS01510 (PVE41_01510) | 309670..309912 | + | 243 | WP_039553847.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PVE41_RS01515 (PVE41_01515) | 309920..310219 | + | 300 | WP_039553850.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PVE41_RS01520 (PVE41_01520) | 310265..310394 | - | 130 | Protein_303 | DUF3265 domain-containing protein | - |
| PVE41_RS01525 (PVE41_01525) | 310404..310949 | - | 546 | WP_282500009.1 | hypothetical protein | - |
| PVE41_RS01530 (PVE41_01530) | 311002..311349 | - | 348 | WP_043920995.1 | hypothetical protein | - |
| PVE41_RS01535 (PVE41_01535) | 311591..312181 | - | 591 | WP_225509125.1 | hypothetical protein | - |
| PVE41_RS01540 (PVE41_01540) | 312290..312367 | - | 78 | Protein_307 | DUF3265 domain-containing protein | - |
| PVE41_RS01545 (PVE41_01545) | 312361..312843 | - | 483 | WP_258493135.1 | tetratricopeptide repeat protein | - |
| PVE41_RS01550 (PVE41_01550) | 312864..312983 | - | 120 | Protein_309 | DUF3265 domain-containing protein | - |
| PVE41_RS01555 (PVE41_01555) | 313459..313866 | - | 408 | WP_108678010.1 | GFA family protein | - |
| PVE41_RS01560 (PVE41_01560) | 313912..314001 | - | 90 | WP_079852034.1 | DUF3265 domain-containing protein | - |
| PVE41_RS01565 (PVE41_01565) | 314019..314396 | - | 378 | WP_017191301.1 | hypothetical protein | - |
| PVE41_RS01570 (PVE41_01570) | 314406..314522 | - | 117 | WP_282500199.1 | DUF3265 domain-containing protein | - |
| PVE41_RS01575 (PVE41_01575) | 314540..314905 | - | 366 | WP_176299820.1 | hypothetical protein | - |
| PVE41_RS01580 (PVE41_01580) | 314978..315118 | - | 141 | WP_282500200.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 251879..392377 | 140498 | |
| - | inside | Integron | - | - | 296711..392377 | 95666 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11416.02 Da Isoelectric Point: 9.6265
>T273126 WP_039553850.1 NZ_CP118438:309920-310219 [Vibrio vulnificus]
MQKNKYKLSNLAQSHLRKAKNYTVENFSELQWRNYKDTLLSGFQMLADNPGLGRSCDEIYPNGFYFPIGKHTAYFTKEDG
FILVVAVLGQSQLPQNHLK
MQKNKYKLSNLAQSHLRKAKNYTVENFSELQWRNYKDTLLSGFQMLADNPGLGRSCDEIYPNGFYFPIGKHTAYFTKEDG
FILVVAVLGQSQLPQNHLK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|