Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 5656828..5657347 | Replicon | chromosome |
Accession | NZ_CP118152 | ||
Organism | Pseudomonas chlororaphis strain ATCC 336631 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PUP64_RS25970 | Protein ID | WP_081360541.1 |
Coordinates | 5657066..5657347 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1H3UB71 |
Locus tag | PUP64_RS25965 | Protein ID | WP_009044432.1 |
Coordinates | 5656828..5657076 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP64_RS25945 (PUP64_25945) | 5652349..5652810 | - | 462 | WP_009049642.1 | YccF domain-containing protein | - |
PUP64_RS25950 (PUP64_25950) | 5652883..5654646 | - | 1764 | WP_081360538.1 | hypothetical protein | - |
PUP64_RS25955 (PUP64_25955) | 5654860..5655858 | - | 999 | WP_081360539.1 | bile acid:sodium symporter family protein | - |
PUP64_RS25960 (PUP64_25960) | 5655943..5656731 | + | 789 | WP_081360540.1 | helix-turn-helix transcriptional regulator | - |
PUP64_RS25965 (PUP64_25965) | 5656828..5657076 | + | 249 | WP_009044432.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PUP64_RS25970 (PUP64_25970) | 5657066..5657347 | + | 282 | WP_081360541.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP64_RS25975 (PUP64_25975) | 5657525..5659174 | - | 1650 | WP_081360542.1 | FMN-binding glutamate synthase family protein | - |
PUP64_RS25980 (PUP64_25980) | 5659231..5659713 | - | 483 | WP_009049637.1 | acyl-CoA thioesterase | - |
PUP64_RS25985 (PUP64_25985) | 5660029..5660820 | - | 792 | WP_081360543.1 | methyltransferase domain-containing protein | - |
PUP64_RS25990 (PUP64_25990) | 5661453..5661725 | - | 273 | WP_081360544.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10821.62 Da Isoelectric Point: 10.5816
>T272884 WP_081360541.1 NZ_CP118152:5657066-5657347 [Pseudomonas chlororaphis]
MTYELEFSEKAWKEWQKLGPTLKEQFKKKLQERLVNPHVPADRLSGLGNAYKIKLRTAGYRLVYRVVDEVLVVTVIAVGK
RERGSVYQQASKR
MTYELEFSEKAWKEWQKLGPTLKEQFKKKLQERLVNPHVPADRLSGLGNAYKIKLRTAGYRLVYRVVDEVLVVTVIAVGK
RERGSVYQQASKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|