Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4314787..4315415 | Replicon | chromosome |
Accession | NZ_CP118152 | ||
Organism | Pseudomonas chlororaphis strain ATCC 336631 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PUP64_RS19860 | Protein ID | WP_038576104.1 |
Coordinates | 4315017..4315415 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PUP64_RS19855 | Protein ID | WP_081359896.1 |
Coordinates | 4314787..4315017 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP64_RS19845 (PUP64_19845) | 4310119..4313535 | - | 3417 | WP_081359894.1 | type I-F CRISPR-associated helicase Cas3f | - |
PUP64_RS19850 (PUP64_19850) | 4313532..4314509 | - | 978 | WP_081359895.1 | type I-F CRISPR-associated endonuclease Cas1f | - |
PUP64_RS19855 (PUP64_19855) | 4314787..4315017 | + | 231 | WP_081359896.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PUP64_RS19860 (PUP64_19860) | 4315017..4315415 | + | 399 | WP_038576104.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PUP64_RS19865 (PUP64_19865) | 4315473..4317422 | - | 1950 | WP_081359897.1 | alkaline phosphatase D family protein | - |
PUP64_RS19870 (PUP64_19870) | 4317558..4318082 | - | 525 | WP_081359898.1 | hypothetical protein | - |
PUP64_RS19875 (PUP64_19875) | 4318079..4318813 | - | 735 | WP_081359899.1 | alpha/beta hydrolase | - |
PUP64_RS19880 (PUP64_19880) | 4318817..4319314 | - | 498 | WP_081363157.1 | PAAR domain-containing protein | - |
PUP64_RS19885 (PUP64_19885) | 4319519..4319695 | - | 177 | WP_164486677.1 | hypothetical protein | - |
PUP64_RS19890 (PUP64_19890) | 4319902..4320177 | - | 276 | WP_038576112.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14886.17 Da Isoelectric Point: 7.2433
>T272883 WP_038576104.1 NZ_CP118152:4315017-4315415 [Pseudomonas chlororaphis]
MLKYMLDTNICIFTIKNKPERVREAFNRQHGRLCISSVTLMELIYGAEKSAAPERNLSVIEGFVARLEVLAYDYEAAIHS
GQLRAELARAGTPIGPYDQLIAGHARSQGLVLVTNNVREFERVPGLRIEDWL
MLKYMLDTNICIFTIKNKPERVREAFNRQHGRLCISSVTLMELIYGAEKSAAPERNLSVIEGFVARLEVLAYDYEAAIHS
GQLRAELARAGTPIGPYDQLIAGHARSQGLVLVTNNVREFERVPGLRIEDWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|