Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 698318..698888 | Replicon | chromosome |
Accession | NZ_CP118152 | ||
Organism | Pseudomonas chlororaphis strain ATCC 336631 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PUP64_RS03190 | Protein ID | WP_081363241.1 |
Coordinates | 698318..698596 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A3G7ICX6 |
Locus tag | PUP64_RS03195 | Protein ID | WP_038580367.1 |
Coordinates | 698598..698888 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP64_RS03175 (PUP64_03175) | 693948..695192 | - | 1245 | WP_029527362.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP64_RS03180 (PUP64_03180) | 695286..696410 | - | 1125 | WP_081362127.1 | diguanylate cyclase | - |
PUP64_RS03185 (PUP64_03185) | 696675..698069 | + | 1395 | WP_081362128.1 | VOC family protein | - |
PUP64_RS03190 (PUP64_03190) | 698318..698596 | + | 279 | WP_081363241.1 | addiction module antitoxin RelB | Toxin |
PUP64_RS03195 (PUP64_03195) | 698598..698888 | + | 291 | WP_038580367.1 | putative addiction module antidote protein | Antitoxin |
PUP64_RS03200 (PUP64_03200) | 699288..699875 | - | 588 | WP_081362129.1 | hypothetical protein | - |
PUP64_RS03205 (PUP64_03205) | 699989..701065 | - | 1077 | WP_081362130.1 | lipocalin-like domain-containing protein | - |
PUP64_RS03210 (PUP64_03210) | 701055..703571 | - | 2517 | WP_232000815.1 | FtsX-like permease family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10061.59 Da Isoelectric Point: 11.0291
>T272879 WP_081363241.1 NZ_CP118152:698318-698596 [Pseudomonas chlororaphis]
MQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGNPLIVLLLGGDKSSQPA
DICQARSLAKEF
MQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGNPLIVLLLGGDKSSQPA
DICQARSLAKEF
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|