Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2647718..2648303 | Replicon | chromosome |
Accession | NZ_CP118141 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17814 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PUP70_RS12275 | Protein ID | WP_053260473.1 |
Coordinates | 2648010..2648303 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PUP70_RS12270 | Protein ID | WP_053260472.1 |
Coordinates | 2647718..2648008 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP70_RS12260 (PUP70_12260) | 2645233..2646615 | + | 1383 | WP_053260470.1 | efflux transporter outer membrane subunit | - |
PUP70_RS12265 (PUP70_12265) | 2646734..2647321 | + | 588 | WP_053260471.1 | hypothetical protein | - |
PUP70_RS12270 (PUP70_12270) | 2647718..2648008 | - | 291 | WP_053260472.1 | putative addiction module antidote protein | Antitoxin |
PUP70_RS12275 (PUP70_12275) | 2648010..2648303 | - | 294 | WP_053260473.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP70_RS12280 (PUP70_12280) | 2648538..2649932 | - | 1395 | WP_053260474.1 | VOC family protein | - |
PUP70_RS12285 (PUP70_12285) | 2650196..2651320 | + | 1125 | WP_053260475.1 | diguanylate cyclase | - |
PUP70_RS12290 (PUP70_12290) | 2651414..2652658 | + | 1245 | WP_053260476.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP70_RS12295 (PUP70_12295) | 2652891..2653286 | + | 396 | WP_007932579.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10846.56 Da Isoelectric Point: 10.5107
>T272810 WP_053260473.1 NZ_CP118141:c2648303-2648010 [Pseudomonas chlororaphis]
MNYEILQTTVFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNMGAGYRLYFTVRGNTLIVLLLGGDK
STQPADICQARYLAKEF
MNYEILQTTVFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNMGAGYRLYFTVRGNTLIVLLLGGDK
STQPADICQARYLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|