Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
Location | 441355..441871 | Replicon | chromosome |
Accession | NZ_CP118141 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17814 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A285EY61 |
Locus tag | PUP70_RS01980 | Protein ID | WP_009041601.1 |
Coordinates | 441590..441871 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PUP70_RS01975 | Protein ID | WP_081002203.1 |
Coordinates | 441355..441600 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP70_RS01950 (PUP70_01950) | 437109..438113 | + | 1005 | WP_053259189.1 | aspartyl beta-hydroxylase | - |
PUP70_RS01955 (PUP70_01955) | 438079..438837 | - | 759 | WP_007932057.1 | slipin family protein | - |
PUP70_RS01960 (PUP70_01960) | 438839..440224 | - | 1386 | WP_053259190.1 | nodulation protein NfeD | - |
PUP70_RS01965 (PUP70_01965) | 440448..440909 | + | 462 | WP_053259191.1 | YbaK/EbsC family protein | - |
PUP70_RS01970 (PUP70_01970) | 441047..441292 | + | 246 | WP_009041599.1 | DUF2789 domain-containing protein | - |
PUP70_RS01975 (PUP70_01975) | 441355..441600 | + | 246 | WP_081002203.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PUP70_RS01980 (PUP70_01980) | 441590..441871 | + | 282 | WP_009041601.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP70_RS01985 (PUP70_01985) | 442003..442431 | + | 429 | WP_053259193.1 | MarR family transcriptional regulator | - |
PUP70_RS01990 (PUP70_01990) | 442428..444512 | + | 2085 | WP_053259194.1 | FUSC family protein | - |
PUP70_RS01995 (PUP70_01995) | 444509..444718 | + | 210 | WP_007932080.1 | DUF1656 domain-containing protein | - |
PUP70_RS02000 (PUP70_02000) | 444715..445611 | + | 897 | WP_053259195.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10879.81 Da Isoelectric Point: 10.5797
>T272806 WP_009041601.1 NZ_CP118141:441590-441871 [Pseudomonas chlororaphis]
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|