Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 7053169..7053788 | Replicon | chromosome |
| Accession | NZ_CP118138 | ||
| Organism | Pseudomonas chlororaphis strain DSM 295782 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285IZB4 |
| Locus tag | PUP77_RS31910 | Protein ID | WP_009043086.1 |
| Coordinates | 7053169..7053351 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP77_RS31915 | Protein ID | WP_053278311.1 |
| Coordinates | 7053387..7053788 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP77_RS31890 (PUP77_31890) | 7050017..7050745 | - | 729 | WP_274320654.1 | hypothetical protein | - |
| PUP77_RS31895 (PUP77_31895) | 7051159..7051440 | + | 282 | WP_274320655.1 | hypothetical protein | - |
| PUP77_RS31900 (PUP77_31900) | 7051805..7052161 | + | 357 | WP_103330827.1 | hypothetical protein | - |
| PUP77_RS31905 (PUP77_31905) | 7052583..7052864 | + | 282 | WP_274320656.1 | hypothetical protein | - |
| PUP77_RS31910 (PUP77_31910) | 7053169..7053351 | + | 183 | WP_009043086.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP77_RS31915 (PUP77_31915) | 7053387..7053788 | + | 402 | WP_053278311.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP77_RS31920 (PUP77_31920) | 7054322..7055575 | - | 1254 | WP_274320657.1 | OprD family porin | - |
| PUP77_RS31925 (PUP77_31925) | 7055707..7057182 | - | 1476 | WP_274320658.1 | aldehyde dehydrogenase family protein | - |
| PUP77_RS31930 (PUP77_31930) | 7057258..7058196 | - | 939 | WP_053278731.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6800.02 Da Isoelectric Point: 11.0738
>T272793 WP_009043086.1 NZ_CP118138:7053169-7053351 [Pseudomonas chlororaphis]
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIKKLAGLI
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIKKLAGLI
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14591.59 Da Isoelectric Point: 4.6017
>AT272793 WP_053278311.1 NZ_CP118138:7053387-7053788 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGIHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGIHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|