Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1459563..1460217 | Replicon | chromosome |
| Accession | NZ_CP118014 | ||
| Organism | Escherichia coli strain B-766 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | PT280_RS07150 | Protein ID | WP_000244772.1 |
| Coordinates | 1459810..1460217 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PT280_RS07145 | Protein ID | WP_000354046.1 |
| Coordinates | 1459563..1459829 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT280_RS07120 (1454851) | 1454851..1455594 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| PT280_RS07125 (1455651) | 1455651..1457084 | - | 1434 | WP_001307385.1 | 6-phospho-beta-glucosidase BglA | - |
| PT280_RS07130 (1457129) | 1457129..1457440 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| PT280_RS07135 (1457604) | 1457604..1458263 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PT280_RS07140 (1458340) | 1458340..1459320 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| PT280_RS07145 (1459563) | 1459563..1459829 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PT280_RS07150 (1459810) | 1459810..1460217 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
| PT280_RS07155 (1460257) | 1460257..1460778 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PT280_RS07160 (1460890) | 1460890..1461786 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PT280_RS07165 (1461811) | 1461811..1462521 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PT280_RS07170 (1462527) | 1462527..1464260 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T272675 WP_000244772.1 NZ_CP118014:1459810-1460217 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |