Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 632123..632842 | Replicon | chromosome |
| Accession | NZ_CP118014 | ||
| Organism | Escherichia coli strain B-766 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | E0J373 |
| Locus tag | PT280_RS03095 | Protein ID | WP_001095907.1 |
| Coordinates | 632123..632443 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E0J374 |
| Locus tag | PT280_RS03100 | Protein ID | WP_001192122.1 |
| Coordinates | 632477..632842 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT280_RS03070 (627801) | 627801..628094 | - | 294 | WP_000805509.1 | protein YicS | - |
| PT280_RS03075 (628316) | 628316..629134 | + | 819 | WP_000779426.1 | lipoprotein NlpA | - |
| PT280_RS03080 (629138) | 629138..630061 | - | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
| PT280_RS03085 (630172) | 630172..631356 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| PT280_RS03090 (631753) | 631753..631914 | - | 162 | Protein_578 | RhuM family protein | - |
| PT280_RS03095 (632123) | 632123..632443 | - | 321 | WP_001095907.1 | TA system toxin CbtA family protein | Toxin |
| PT280_RS03100 (632477) | 632477..632842 | - | 366 | WP_001192122.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PT280_RS03105 (632874) | 632874..633095 | - | 222 | WP_000691985.1 | DUF987 family protein | - |
| PT280_RS03110 (633104) | 633104..633574 | - | 471 | WP_000104319.1 | DNA repair protein RadC | - |
| PT280_RS03115 (633644) | 633644..634465 | - | 822 | WP_000197395.1 | DUF932 domain-containing protein | - |
| PT280_RS03120 (634537) | 634537..635013 | - | 477 | WP_001254693.1 | hypothetical protein | - |
| PT280_RS03125 (635230) | 635230..636033 | - | 804 | WP_001245321.1 | hypothetical protein | - |
| PT280_RS03130 (636265) | 636265..637429 | + | 1165 | Protein_586 | IS3-like element IS3 family transposase | - |
| PT280_RS03135 (637457) | 637457..637750 | - | 294 | WP_000945828.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12184.76 Da Isoelectric Point: 5.5740
>T272671 WP_001095907.1 NZ_CP118014:c632443-632123 [Escherichia coli]
MNTPTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVRRAQFNLGLKRS
MNTPTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVRRAQFNLGLKRS
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|