Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3056001..3056796 Replicon chromosome
Accession NZ_CP117959
Organism Escherichia coli strain B-2207

Toxin (Protein)


Gene name yeeV Uniprot ID A0A4Y9BN12
Locus tag PT284_RS15620 Protein ID WP_023909482.1
Coordinates 3056422..3056796 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag PT284_RS15615 Protein ID WP_001522275.1
Coordinates 3056001..3056375 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT284_RS15580 (3051167) 3051167..3051985 + 819 WP_001522287.1 DUF932 domain-containing protein -
PT284_RS15585 (3051985) 3051985..3052161 + 177 WP_001522285.1 hypothetical protein -
PT284_RS15590 (3052256) 3052256..3052729 + 474 WP_001522284.1 antirestriction protein -
PT284_RS15595 (3052744) 3052744..3053220 + 477 WP_001186724.1 RadC family protein -
PT284_RS15600 (3053401) 3053401..3054897 + 1497 Protein_2907 IS21-like element ISEc10 family transposase -
PT284_RS15605 (3054894) 3054894..3055648 + 755 Protein_2908 IS21-like element ISEc10 family helper ATPase IstB -
PT284_RS15610 (3055700) 3055700..3055921 + 222 WP_023909484.1 DUF987 domain-containing protein -
PT284_RS15615 (3056001) 3056001..3056375 + 375 WP_001522275.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PT284_RS15620 (3056422) 3056422..3056796 + 375 WP_023909482.1 TA system toxin CbtA family protein Toxin
PT284_RS15625 (3056793) 3056793..3057283 + 491 Protein_2912 DUF5983 family protein -
PT284_RS15630 (3057295) 3057295..3057492 + 198 WP_001522268.1 DUF957 domain-containing protein -
PT284_RS15635 (3057577) 3057577..3058443 + 867 WP_023909479.1 DUF4942 domain-containing protein -
PT284_RS15640 (3058515) 3058515..3058778 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
PT284_RS15645 (3058775) 3058775..3059101 + 327 WP_001522265.1 type II toxin-antitoxin system RelE/ParE family toxin -
PT284_RS15650 (3059578) 3059578..3059748 + 171 Protein_2917 IS110 family transposase -
PT284_RS15655 (3060559) 3060559..3061542 + 984 WP_066008910.1 KpsF/GutQ family sugar-phosphate isomerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / kpsT / kpsM / gspM / gspL / gspK 3025736..3130083 104347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14009.98 Da        Isoelectric Point: 8.2905

>T272505 WP_023909482.1 NZ_CP117959:3056422-3056796 [Escherichia coli]
MKTLSDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRTVNNITQGKHPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13630.35 Da        Isoelectric Point: 5.5051

>AT272505 WP_001522275.1 NZ_CP117959:3056001-3056375 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Y9BN12

Antitoxin

Source ID Structure

References