Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1994565..1995397 | Replicon | chromosome |
| Accession | NZ_CP117959 | ||
| Organism | Escherichia coli strain B-2207 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | PT284_RS10630 | Protein ID | WP_000854765.1 |
| Coordinates | 1995023..1995397 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PT284_RS10625 | Protein ID | WP_274271358.1 |
| Coordinates | 1994565..1994933 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT284_RS10590 (1990164) | 1990164..1990349 | - | 186 | WP_000457347.1 | transposase | - |
| PT284_RS10595 (1990364) | 1990364..1991470 | - | 1107 | WP_274271356.1 | IS66 family transposase | - |
| PT284_RS10600 (1991750) | 1991750..1992096 | - | 347 | Protein_1933 | IS66 family insertion sequence element accessory protein TnpB | - |
| PT284_RS10605 (1992096) | 1992096..1992674 | - | 579 | WP_274271357.1 | IS66-like element accessory protein TnpA | - |
| PT284_RS10610 (1993153) | 1993153..1993626 | + | 474 | WP_000855059.1 | antirestriction protein | - |
| PT284_RS10615 (1993642) | 1993642..1994118 | + | 477 | WP_001186774.1 | RadC family protein | - |
| PT284_RS10620 (1994181) | 1994181..1994402 | + | 222 | WP_023356553.1 | DUF987 domain-containing protein | - |
| PT284_RS10625 (1994565) | 1994565..1994933 | + | 369 | WP_274271358.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PT284_RS10630 (1995023) | 1995023..1995397 | + | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| PT284_RS10635 (1995394) | 1995394..1995546 | + | 153 | Protein_1940 | DUF5983 family protein | - |
| PT284_RS10640 (1995646) | 1995646..1995726 | + | 81 | Protein_1941 | hypothetical protein | - |
| PT284_RS10645 (1995990) | 1995990..1996735 | - | 746 | Protein_1942 | IS21-like element ISEc12 family helper ATPase IstB | - |
| PT284_RS10650 (1996750) | 1996750..1998287 | - | 1538 | Protein_1943 | IS21-like element ISEc12 family transposase | - |
| PT284_RS10655 (1998481) | 1998481..1998979 | + | 499 | Protein_1944 | transposase | - |
| PT284_RS10660 (1999105) | 1999105..1999494 | + | 390 | WP_077249349.1 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 1990164..2001633 | 11469 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T272501 WP_000854765.1 NZ_CP117959:1995023-1995397 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13563.31 Da Isoelectric Point: 5.9598
>AT272501 WP_274271358.1 NZ_CP117959:1994565-1994933 [Escherichia coli]
VSDTLSGATHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGATHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|