Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 948943..949741 | Replicon | chromosome |
| Accession | NZ_CP117959 | ||
| Organism | Escherichia coli strain B-2207 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | PT284_RS05320 | Protein ID | WP_066009386.1 |
| Coordinates | 949364..949741 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7UP42 |
| Locus tag | PT284_RS05315 | Protein ID | WP_001280955.1 |
| Coordinates | 948943..949317 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT284_RS05285 (944296) | 944296..945201 | + | 906 | WP_000203541.1 | diguanylate cyclase regulator RdcB family protein | - |
| PT284_RS05290 (945198) | 945198..946268 | + | 1071 | WP_053886242.1 | patatin-like phospholipase family protein | - |
| PT284_RS05295 (946608) | 946608..947426 | + | 819 | WP_274271255.1 | DUF932 domain-containing protein | - |
| PT284_RS05300 (947517) | 947517..948002 | + | 486 | WP_023910464.1 | antirestriction protein | - |
| PT284_RS05305 (948018) | 948018..948496 | + | 479 | Protein_894 | RadC family protein | - |
| PT284_RS05310 (948559) | 948559..948780 | + | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| PT284_RS05315 (948943) | 948943..949317 | + | 375 | WP_001280955.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PT284_RS05320 (949364) | 949364..949741 | + | 378 | WP_066009386.1 | TA system toxin CbtA family protein | Toxin |
| PT284_RS05325 (949738) | 949738..950226 | + | 489 | WP_044704957.1 | DUF5983 family protein | - |
| PT284_RS05330 (950193) | 950193..950321 | + | 129 | Protein_899 | hypothetical protein | - |
| PT284_RS05335 (950382) | 950382..951137 | - | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
| PT284_RS05340 (951134) | 951134..952633 | - | 1500 | WP_274271256.1 | IS21-like element ISEc10 family transposase | - |
| PT284_RS05345 (952687) | 952687..953514 | + | 828 | WP_031326415.1 | DUF4942 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | csgG / csgF / csgE / csgD / csgB / csgA / csgC | 948943..962453 | 13510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14247.32 Da Isoelectric Point: 8.2905
>T272494 WP_066009386.1 NZ_CP117959:949364-949741 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13767.59 Da Isoelectric Point: 6.6248
>AT272494 WP_001280955.1 NZ_CP117959:948943-949317 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|