Detailed information of TA system TA272488

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 106826..107252
• Replicon: plasmid unnamed1
• Accession: NZ_CP117958
• Organism: Escherichia coli strain B-2207

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PT284_RS00620
• Protein ID: WP_001372321.1
• Coordinates: 106826..106951 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	107028..107252 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PT284_RS00575 (101937)	101937..102164	-	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
PT284_RS00580 (102252)	102252..102929	-	678	WP_001348626.1	PAS domain-containing protein	-
PT284_RS00585 (103063)	103063..103446	-	384	WP_001151566.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PT284_RS00590 (103777)	103777..104379	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
PT284_RS00595 (104676)	104676..105497	-	822	WP_001234469.1	DUF932 domain-containing protein	-
PT284_RS00600 (105617)	105617..105904	-	288	WP_021528457.1	hypothetical protein	-
PT284_RS00605 (105929)	105929..106135	-	207	WP_000547968.1	hypothetical protein	-
PT284_RS00610 (106205)	106205..106378	+	174	Protein_121	hypothetical protein	-
PT284_RS00615 (106376)	106376..106606	-	231	WP_001426396.1	hypothetical protein	-
PT284_RS00620 (106826)	106826..106951	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PT284_RS00625 (106893)	106893..107042	-	150	Protein_124	plasmid maintenance protein Mok	-
- (107028)	107028..107252	-	225	NuclAT_0	-	Antitoxin
- (107028)	107028..107252	-	225	NuclAT_0	-	Antitoxin
- (107028)	107028..107252	-	225	NuclAT_0	-	Antitoxin
- (107028)	107028..107252	-	225	NuclAT_0	-	Antitoxin
PT284_RS00630 (107064)	107064..107252	+	189	WP_001299721.1	hypothetical protein	-
PT284_RS00635 (107221)	107221..107983	-	763	Protein_126	plasmid SOS inhibition protein A	-
PT284_RS00640 (107980)	107980..108414	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PT284_RS00645 (108469)	108469..110427	-	1959	WP_021528456.1	ParB/RepB/Spo0J family partition protein	-
PT284_RS00650 (110493)	110493..110726	-	234	WP_000005990.1	DUF905 family protein	-
PT284_RS00655 (110789)	110789..111328	-	540	WP_000290839.1	single-stranded DNA-binding protein	-
PT284_RS00660 (111354)	111354..111560	-	207	WP_000275853.1	hypothetical protein	-
PT284_RS00665 (111799)	111799..112032	-	234	WP_102384970.1	hypothetical protein	-
PT284_RS00670 (111969)	111969..112157	-	189	WP_102360578.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	iucA / iucB / iucB / iucC / iucD / iutA	1..122293	122293

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T272488 WP_001372321.1 NZ_CP117958:c106951-106826 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT272488 NZ_CP117958:c107252-107028 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin