Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 5094747..5095376 | Replicon | chromosome |
| Accession | NZ_CP117876 | ||
| Organism | Paenibacillus sp. KACC 21273 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PQ460_RS22375 | Protein ID | WP_274171229.1 |
| Coordinates | 5094747..5095073 (-) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PQ460_RS22380 | Protein ID | WP_274171230.1 |
| Coordinates | 5095134..5095376 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ460_RS22345 (PQ460_22345) | 5091841..5092065 | + | 225 | WP_069329692.1 | hypothetical protein | - |
| PQ460_RS22350 (PQ460_22350) | 5092211..5092555 | - | 345 | WP_274171227.1 | hypothetical protein | - |
| PQ460_RS22355 (PQ460_22355) | 5092754..5092927 | - | 174 | WP_273614470.1 | hypothetical protein | - |
| PQ460_RS22360 (PQ460_22360) | 5093160..5093405 | - | 246 | WP_274171228.1 | hypothetical protein | - |
| PQ460_RS22365 (PQ460_22365) | 5093544..5093987 | + | 444 | WP_273614469.1 | DUF6376 family protein | - |
| PQ460_RS22370 (PQ460_22370) | 5094223..5094555 | - | 333 | WP_273614468.1 | hypothetical protein | - |
| PQ460_RS22375 (PQ460_22375) | 5094747..5095073 | - | 327 | WP_274171229.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PQ460_RS22380 (PQ460_22380) | 5095134..5095376 | - | 243 | WP_274171230.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PQ460_RS22385 (PQ460_22385) | 5095517..5098612 | - | 3096 | WP_274171231.1 | efflux RND transporter permease subunit | - |
| PQ460_RS22390 (PQ460_22390) | 5098614..5100089 | - | 1476 | WP_274171232.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12376.32 Da Isoelectric Point: 6.9662
>T272452 WP_274171229.1 NZ_CP117876:c5095073-5094747 [Paenibacillus sp. KACC 21273]
MSYIPSQGDIIYLDFNPTKGYEQAGHRPAVVVSNNEFHRTGMMMVVPVTNTIQRHPLHIHLNEDNKIKGKIMCEQMKSLD
YKARSPYKVDVLPSSILEEVIEIIQSCF
MSYIPSQGDIIYLDFNPTKGYEQAGHRPAVVVSNNEFHRTGMMMVVPVTNTIQRHPLHIHLNEDNKIKGKIMCEQMKSLD
YKARSPYKVDVLPSSILEEVIEIIQSCF
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|