272293

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 738722..739199 Replicon chromosome
Accession NZ_CP117820
Organism Xylella fastidiosa strain ICMP 8740

Toxin (Protein)


Gene name pasB Uniprot ID -
Locus tag PT012_RS03325 Protein ID WP_004087087.1
Coordinates 738722..738988 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A7G7TPD2
Locus tag PT012_RS03330 Protein ID WP_004091377.1
Coordinates 738972..739199 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT012_RS03300 (PT012_03300) 734276..735574 + 1299 WP_272819578.1 DUF2213 domain-containing protein -
PT012_RS03305 (PT012_03305) 735584..736066 + 483 WP_004090290.1 hypothetical protein -
PT012_RS03310 (PT012_03310) 736076..736414 + 339 WP_274169886.1 hypothetical protein -
PT012_RS03315 (PT012_03315) 736432..736674 + 243 WP_234499994.1 putative phage tail assembly chaperone -
PT012_RS03320 (PT012_03320) 736822..738711 + 1890 WP_274169885.1 hypothetical protein -
PT012_RS03325 (PT012_03325) 738722..738988 - 267 WP_004087087.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PT012_RS03330 (PT012_03330) 738972..739199 - 228 WP_004091377.1 DUF6290 family protein Antitoxin
PT012_RS03335 (PT012_03335) 739310..740080 + 771 WP_274169884.1 hypothetical protein -
PT012_RS03340 (PT012_03340) 740080..740397 + 318 WP_012382585.1 hypothetical protein -
PT012_RS03345 (PT012_03345) 740394..741224 + 831 WP_027700631.1 hypothetical protein -
PT012_RS03350 (PT012_03350) 741221..741862 + 642 WP_012382583.1 Gp138 family membrane-puncturing spike protein -
PT012_RS03355 (PT012_03355) 741859..742212 + 354 WP_027700632.1 hypothetical protein -
PT012_RS03360 (PT012_03360) 742268..742561 - 294 WP_004085592.1 putative addiction module antidote protein -
PT012_RS03365 (PT012_03365) 742564..742860 - 297 WP_004085590.1 type II toxin-antitoxin system RelE/ParE family toxin -
PT012_RS03370 (PT012_03370) 742963..744108 + 1146 WP_027700633.1 baseplate J/gp47 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 701573..745913 44340


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10207.80 Da        Isoelectric Point: 10.3398

>T272293 WP_004087087.1 NZ_CP117820:c738988-738722 [Xylella fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCDIQDSVLRVLVVRV
GHRGEIYR

Download         Length: 267 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8615.63 Da        Isoelectric Point: 5.0958

>AT272293 WP_004091377.1 NZ_CP117820:c739199-738972 [Xylella fastidiosa]
MATSIRLSPEMEQRLNSLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7G7TPD2

References