Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 21837..22495 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP117763 | ||
| Organism | Acinetobacter baumannii strain 2022CK-00839 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PTC93_RS19500 | Protein ID | WP_000312250.1 |
| Coordinates | 21837..22196 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PTC93_RS19505 | Protein ID | WP_001096429.1 |
| Coordinates | 22196..22495 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC93_RS19470 (PTC93_19450) | 17358..17672 | - | 315 | WP_000708714.1 | hypothetical protein | - |
| PTC93_RS19475 (PTC93_19455) | 18727..19485 | - | 759 | WP_001053127.1 | hypothetical protein | - |
| PTC93_RS19480 (PTC93_19460) | 19552..19935 | - | 384 | WP_000654348.1 | hypothetical protein | - |
| PTC93_RS19485 (PTC93_19465) | 20074..20772 | - | 699 | WP_264208834.1 | hypothetical protein | - |
| PTC93_RS19490 (PTC93_19470) | 20839..21021 | - | 183 | WP_000373385.1 | hypothetical protein | - |
| PTC93_RS19495 (PTC93_19475) | 21070..21636 | - | 567 | WP_000710385.1 | hypothetical protein | - |
| PTC93_RS19500 (PTC93_19480) | 21837..22196 | + | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PTC93_RS19505 (PTC93_19485) | 22196..22495 | + | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| PTC93_RS19510 (PTC93_19490) | 23033..23569 | - | 537 | WP_000731978.1 | hypothetical protein | - |
| PTC93_RS19515 (PTC93_19495) | 23619..24173 | - | 555 | WP_000790084.1 | hypothetical protein | - |
| PTC93_RS19520 (PTC93_19500) | 24193..24411 | - | 219 | WP_001043201.1 | hypothetical protein | - |
| PTC93_RS19525 (PTC93_19505) | 24451..25080 | - | 630 | WP_000701003.1 | hypothetical protein | - |
| PTC93_RS19530 (PTC93_19510) | 25097..25276 | - | 180 | WP_000387630.1 | hypothetical protein | - |
| PTC93_RS19535 (PTC93_19515) | 25252..25824 | - | 573 | WP_000443897.1 | hypothetical protein | - |
| PTC93_RS19540 (PTC93_19520) | 25829..26086 | - | 258 | WP_000834290.1 | hypothetical protein | - |
| PTC93_RS19545 (PTC93_19525) | 26191..27471 | - | 1281 | WP_001093570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..66484 | 66484 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T272259 WP_000312250.1 NZ_CP117763:21837-22196 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|