Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 6098..6367 | Replicon | plasmid pB1S11 |
| Accession | NZ_CP117718 | ||
| Organism | Escherichia coli strain B1S11 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PTA69_RS24125 | Protein ID | WP_001372321.1 |
| Coordinates | 6242..6367 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 6098..6163 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA69_RS24070 | 1317..2288 | + | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
| PTA69_RS24075 | 2925..3094 | + | 170 | Protein_2 | hypothetical protein | - |
| PTA69_RS24080 | 3277..3357 | - | 81 | Protein_3 | hypothetical protein | - |
| PTA69_RS24085 | 3427..3633 | + | 207 | WP_000275856.1 | hypothetical protein | - |
| PTA69_RS24090 | 3659..4198 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| PTA69_RS24095 | 4266..4499 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
| PTA69_RS24100 | 4527..4724 | + | 198 | Protein_7 | hypothetical protein | - |
| PTA69_RS24105 | 4779..5213 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| PTA69_RS24110 | 5210..5972 | + | 763 | Protein_9 | plasmid SOS inhibition protein A | - |
| PTA69_RS24115 | 5941..6129 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 5941..6165 | + | 225 | NuclAT_0 | - | - |
| - | 5941..6165 | + | 225 | NuclAT_0 | - | - |
| - | 5941..6165 | + | 225 | NuclAT_0 | - | - |
| - | 5941..6165 | + | 225 | NuclAT_0 | - | - |
| - | 6098..6163 | - | 66 | - | - | Antitoxin |
| PTA69_RS24120 | 6151..6300 | + | 150 | Protein_11 | plasmid maintenance protein Mok | - |
| PTA69_RS24125 | 6242..6367 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PTA69_RS24130 | 6587..6817 | + | 231 | WP_071586998.1 | hypothetical protein | - |
| PTA69_RS24135 | 6815..6987 | - | 173 | Protein_14 | hypothetical protein | - |
| PTA69_RS24140 | 7057..7281 | + | 225 | WP_107193629.1 | single-stranded DNA-binding protein | - |
| PTA69_RS24145 | 7753..9225 | - | 1473 | WP_273925326.1 | caspase family protein | - |
| PTA69_RS24150 | 9608..10267 | - | 660 | Protein_17 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / tet(A) / qnrS1 / dfrA14 / blaTEM-1C / sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..151146 | 151146 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T272123 WP_001372321.1 NZ_CP117718:6242-6367 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT272123 NZ_CP117718:c6163-6098 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|