Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2075166..2075817 | Replicon | chromosome |
| Accession | NZ_CP117678 | ||
| Organism | Escherichia albertii strain BIA_4 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B1EG01 |
| Locus tag | PS033_RS10455 | Protein ID | WP_000244763.1 |
| Coordinates | 2075166..2075570 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PS033_RS10460 | Protein ID | WP_000354046.1 |
| Coordinates | 2075551..2075817 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS033_RS10435 (2071124) | 2071124..2072857 | - | 1734 | WP_059221131.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PS033_RS10440 (2072863) | 2072863..2073573 | - | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PS033_RS10445 (2073598) | 2073598..2074494 | - | 897 | WP_059268127.1 | site-specific tyrosine recombinase XerD | - |
| PS033_RS10450 (2074606) | 2074606..2075127 | + | 522 | WP_059221135.1 | flavodoxin FldB | - |
| PS033_RS10455 (2075166) | 2075166..2075570 | - | 405 | WP_000244763.1 | protein YgfX | Toxin |
| PS033_RS10460 (2075551) | 2075551..2075817 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PS033_RS10465 (2075807) | 2075807..2076037 | - | 231 | WP_000181267.1 | hypothetical protein | - |
| PS033_RS10470 (2076069) | 2076069..2077049 | + | 981 | WP_059221136.1 | tRNA-modifying protein YgfZ | - |
| PS033_RS10475 (2077370) | 2077370..2078029 | - | 660 | WP_000250281.1 | hemolysin III family protein | - |
| PS033_RS10480 (2078197) | 2078197..2078508 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| PS033_RS10485 (2078553) | 2078553..2079986 | + | 1434 | WP_059221179.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T272009 WP_000244763.1 NZ_CP117678:c2075570-2075166 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6P9B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |