Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3809321..3809579 | Replicon | chromosome |
| Accession | NZ_CP117668 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PS054_RS18775 | Protein ID | WP_000809168.1 |
| Coordinates | 3809321..3809473 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3809522..3809579 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS18760 | 3804732..3806648 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| PS054_RS18765 | 3806737..3807867 | + | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| PS054_RS18770 | 3808130..3809243 | - | 1114 | Protein_3656 | IS4-like element IS421 family transposase | - |
| PS054_RS18775 | 3809321..3809473 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 3809522..3809579 | + | 58 | - | - | Antitoxin |
| PS054_RS18780 | 3810095..3810856 | + | 762 | WP_001276206.1 | outer membrane protein OmpK | - |
| PS054_RS18785 | 3810877..3812370 | + | 1494 | WP_273814136.1 | sulfatase-like hydrolase/transferase | - |
| PS054_RS18790 | 3812524..3813771 | + | 1248 | WP_273814138.1 | cytoplasmic protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | espX1 | 3808130..3817709 | 9579 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271970 WP_000809168.1 NZ_CP117668:c3809473-3809321 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271970 NZ_CP117668:3809522-3809579 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|