Detailed information of TA system TA271959

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 1156216..1156441
• Replicon: chromosome
• Accession: NZ_CP117668
• Organism: Escherichia albertii strain BIA_11

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: A0A8H9SPE4
• Locus tag: PS054_RS06060
• Protein ID: WP_001406737.1
• Coordinates: 1156216..1156371 (-)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	1156383..1156441 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS054_RS06010	1151483..1151698	-	216	WP_000839596.1	phage lysis protein EssD	-
PS054_RS06015	1152414..1152977	+	564	WP_024246368.1	DUF1440 domain-containing protein	-
PS054_RS06040	1153661..1154350	-	690	WP_059222310.1	bacteriophage antitermination protein Q	-
PS054_RS06045	1154347..1154712	-	366	WP_054413016.1	RusA family crossover junction endodeoxyribonuclease	-
PS054_RS06050	1154713..1155768	-	1056	WP_059259435.1	DUF968 domain-containing protein	-
PS054_RS06055	1155770..1156048	-	279	WP_059225803.1	hypothetical protein	-
PS054_RS06060	1156216..1156371	-	156	WP_001406737.1	type I toxin-antitoxin system toxin HokD	Toxin
-	1156383..1156441	+	59	-	-	Antitoxin
PS054_RS06065	1156583..1156711	-	129	WP_256876870.1	hypothetical protein	-
PS054_RS06070	1156922..1157119	-	198	Protein_1197	DUF551 domain-containing protein	-
PS054_RS06075	1157266..1157673	-	408	WP_059259431.1	hypothetical protein	-
PS054_RS06080	1157832..1158248	-	417	WP_059274262.1	DUF977 family protein	-
PS054_RS06085	1158256..1159017	-	762	WP_059225509.1	DUF1627 domain-containing protein	-
PS054_RS06090	1159041..1159787	-	747	WP_113650040.1	ATP-binding protein	-
PS054_RS06095	1159794..1160756	-	963	WP_131110102.1	helix-turn-helix domain-containing protein	-
PS054_RS06100	1160780..1161205	-	426	WP_059259424.1	toxin YdaT family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	espJ / espFu/tccP / nleC / nleC / rhs/PAAR	1121631..1178691	57060

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5794.93 Da
• Isoelectric Point: 4.8535

>T271959 WP_001406737.1 NZ_CP117668:c1156371-1156216 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271959 NZ_CP117668:1156383-1156441 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA

Structures

Antitoxin