Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 106253..106478 | Replicon | chromosome |
| Accession | NZ_CP117668 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | E0IUP2 |
| Locus tag | PS054_RS00530 | Protein ID | WP_000813259.1 |
| Coordinates | 106323..106478 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 106253..106311 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS00480 | 101489..101707 | - | 219 | WP_001171946.1 | protein YdfC | - |
| PS054_RS00485 | 101737..101865 | - | 129 | WP_000344964.1 | protein YdfB | - |
| PS054_RS00490 | 101867..102022 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
| PS054_RS00495 | 102191..102598 | - | 408 | WP_000381213.1 | helix-turn-helix domain-containing protein | - |
| PS054_RS00500 | 102679..102906 | + | 228 | WP_000921592.1 | Cro/CI family transcriptional regulator | - |
| PS054_RS00505 | 102890..103411 | + | 522 | WP_095575638.1 | toxin YdaT family protein | - |
| PS054_RS00510 | 103392..104357 | + | 966 | WP_123057873.1 | hypothetical protein | - |
| PS054_RS00515 | 104398..104820 | + | 423 | WP_273814609.1 | DUF977 family protein | - |
| PS054_RS00520 | 104958..105230 | - | 273 | WP_059268374.1 | hypothetical protein | - |
| PS054_RS00525 | 105502..106085 | + | 584 | Protein_104 | epoxyqueuosine reductase QueH | - |
| - | 106253..106311 | - | 59 | - | - | Antitoxin |
| PS054_RS00530 | 106323..106478 | + | 156 | WP_000813259.1 | Hok/Gef family protein | Toxin |
| PS054_RS00535 | 106754..107014 | + | 261 | WP_273814611.1 | hypothetical protein | - |
| PS054_RS00540 | 107081..107359 | + | 279 | WP_095575641.1 | hypothetical protein | - |
| PS054_RS00545 | 107361..108416 | + | 1056 | WP_273814613.1 | DUF968 domain-containing protein | - |
| PS054_RS00550 | 108417..108782 | + | 366 | WP_273814615.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PS054_RS00555 | 108779..109468 | + | 690 | WP_095575644.1 | bacteriophage antitermination protein Q | - |
| PS054_RS00560 | 109602..110462 | + | 861 | WP_273814617.1 | DUF5677 domain-containing protein | - |
| PS054_RS00565 | 110629..111015 | + | 387 | WP_095575645.1 | phage holin family protein | - |
| PS054_RS00570 | 111002..111283 | + | 282 | WP_073978423.1 | phage holin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 95601..134806 | 39205 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5795.96 Da Isoelectric Point: 7.7951
>T271947 WP_000813259.1 NZ_CP117668:106323-106478 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESRE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESRE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271947 NZ_CP117668:c106311-106253 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
