Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2530637..2530862 | Replicon | chromosome |
| Accession | NZ_CP117659 | ||
| Organism | Escherichia albertii strain BIA_13 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | PS034_RS12365 | Protein ID | WP_000813254.1 |
| Coordinates | 2530637..2530792 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2530804..2530862 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS034_RS12315 | 2526255..2526512 | - | 258 | Protein_2413 | ParB/Srx family N-terminal domain-containing protein | - |
| PS034_RS12320 | 2526631..2526753 | - | 123 | WP_262409882.1 | hypothetical protein | - |
| PS034_RS12325 | 2526798..2527076 | - | 279 | WP_233991579.1 | hypothetical protein | - |
| PS034_RS12330 | 2526961..2527353 | - | 393 | WP_059214839.1 | DUF2570 domain-containing protein | - |
| PS034_RS12335 | 2527337..2527813 | - | 477 | WP_001194114.1 | glycoside hydrolase family protein | - |
| PS034_RS12340 | 2527817..2528152 | - | 336 | WP_001766841.1 | phage holin, lambda family | - |
| PS034_RS12345 | 2528650..2529192 | - | 543 | WP_059214837.1 | DUF1133 family protein | - |
| PS034_RS12350 | 2529189..2529430 | - | 242 | Protein_2420 | DUF1364 domain-containing protein | - |
| PS034_RS12355 | 2529478..2530077 | - | 600 | WP_059214836.1 | DUF1367 family protein | - |
| PS034_RS12360 | 2530149..2530361 | - | 213 | WP_072248386.1 | hypothetical protein | - |
| PS034_RS12365 | 2530637..2530792 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2530804..2530862 | + | 59 | - | - | Antitoxin |
| PS034_RS12370 | 2531339..2531890 | - | 552 | WP_233991578.1 | DUF551 domain-containing protein | - |
| PS034_RS12375 | 2531892..2532320 | - | 429 | WP_233991577.1 | hypothetical protein | - |
| PS034_RS12380 | 2532451..2532753 | - | 303 | WP_273810571.1 | hypothetical protein | - |
| PS034_RS12385 | 2532749..2533013 | - | 265 | Protein_2427 | hypothetical protein | - |
| PS034_RS12390 | 2533010..2533426 | - | 417 | WP_273810515.1 | DUF977 family protein | - |
| PS034_RS12395 | 2533434..2534195 | - | 762 | WP_273810514.1 | DUF1627 domain-containing protein | - |
| PS034_RS12400 | 2534218..2534964 | - | 747 | WP_048969775.1 | ATP-binding protein | - |
| PS034_RS12405 | 2534971..2535759 | - | 789 | WP_059279425.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2502202..2545584 | 43382 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T271929 WP_000813254.1 NZ_CP117659:c2530792-2530637 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271929 NZ_CP117659:2530804-2530862 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
