Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2355802..2356406 | Replicon | chromosome |
| Accession | NZ_CP117659 | ||
| Organism | Escherichia albertii strain BIA_13 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | B1EM00 |
| Locus tag | PS034_RS11590 | Protein ID | WP_000638401.1 |
| Coordinates | 2356020..2356406 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS034_RS11585 | Protein ID | WP_001195490.1 |
| Coordinates | 2355802..2356023 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS034_RS11565 (2351045) | 2351045..2352679 | + | 1635 | WP_273823045.1 | hypothetical protein | - |
| PS034_RS11570 (2352697) | 2352697..2352984 | + | 288 | WP_089589836.1 | DUF2523 family protein | - |
| PS034_RS11575 (2352996) | 2352996..2354054 | + | 1059 | WP_273823047.1 | zonular occludens toxin domain-containing protein | - |
| PS034_RS11580 (2354051) | 2354051..2355310 | + | 1260 | WP_062863914.1 | type II secretion system protein GspD | - |
| PS034_RS11585 (2355802) | 2355802..2356023 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS034_RS11590 (2356020) | 2356020..2356406 | + | 387 | WP_000638401.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14505.49 Da Isoelectric Point: 8.0833
>T271928 WP_000638401.1 NZ_CP117659:2356020-2356406 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T5VDW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6PD20 |